Metadata-Version: 2.4
Name: boltzyml
Version: 1.0.1
Summary: Preprocessing file generator for Boltz-2 ternary (Protein 1 + Ligand + Protein 2) binding prediction.
Project-URL: Homepage, https://ayushmania2002.github.io/boltzyml/
Project-URL: Repository, https://github.com/Ayushmania2002/boltzyml
Project-URL: Issues, https://github.com/Ayushmania2002/boltzyml/issues
Author-email: Ayushman Mallick <ayushmania2002@gmail.com>
Maintainer-email: Ayushman Mallick <ayushmania2002@gmail.com>
License-Expression: MIT
License-File: LICENSE
Keywords: binding-prediction,bioinformatics,boltz,boltz-2,cif,protein-ligand,structural-biology,yaml
Classifier: Development Status :: 4 - Beta
Classifier: Environment :: Console
Classifier: Intended Audience :: Science/Research
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3 :: Only
Classifier: Programming Language :: Python :: 3.10
Classifier: Programming Language :: Python :: 3.11
Classifier: Programming Language :: Python :: 3.12
Classifier: Programming Language :: Python :: 3.13
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: Topic :: Scientific/Engineering :: Chemistry
Requires-Python: >=3.10
Provides-Extra: dev
Requires-Dist: build; extra == 'dev'
Requires-Dist: pytest>=7; extra == 'dev'
Requires-Dist: twine; extra == 'dev'
Description-Content-Type: text/markdown

<p align="center">
  <img src="https://raw.githubusercontent.com/Ayushmania2002/boltzyml/main/banner.png" alt="BoltzYML pipeline overview" width="780">
</p>

<h1 align="center">BoltzYML</h1>

<p align="center">
  <strong>Preprocessing-file generator for ternary (Protein 1 + Ligand + Protein 2) binding prediction with <a href="https://github.com/jwohlwend/boltz">Boltz-2</a>.</strong>
</p>

<p align="center">
  <a href="https://pypi.org/project/boltzyml/"><img src="https://img.shields.io/pypi/v/boltzyml.svg?color=2563eb&label=PyPI&v=1" alt="PyPI version"></a>
  <a href="https://pypi.org/project/boltzyml/"><img src="https://img.shields.io/pypi/pyversions/boltzyml.svg?color=2563eb&label=Python&v=1" alt="Python versions"></a>
  <a href="https://pypistats.org/packages/boltzyml"><img src="https://img.shields.io/pypi/dm/boltzyml.svg?color=2563eb&label=downloads&v=1" alt="PyPI downloads"></a>
  <a href="https://github.com/Ayushmania2002/boltzyml/blob/main/LICENSE"><img src="https://img.shields.io/pypi/l/boltzyml.svg?color=0e9f6e&label=license&v=1" alt="License"></a>
  <a href="https://github.com/Ayushmania2002/boltzyml/stargazers"><img src="https://img.shields.io/github/stars/Ayushmania2002/boltzyml.svg?color=f59e0b&label=stars&v=1" alt="GitHub stars"></a>
  <a href="https://ayushmania2002.github.io/boltzyml/"><img src="https://img.shields.io/badge/web%20app-live-0e9f6e.svg?v=1" alt="Web app"></a>
  <a href="https://doi.org/10.5281/zenodo.20397272"><img src="https://img.shields.io/badge/DOI-10.5281%2Fzenodo.20397272-3C7EBC.svg?v=1" alt="Zenodo DOI"></a>
</p>

<p align="center">
  <a href="https://ayushmania2002.github.io/boltzyml/"><b>Live web app →</b></a>
  &nbsp;·&nbsp;
  <a href="#cli">CLI</a>
  &nbsp;·&nbsp;
  <a href="#how-it-works">How it works</a>
</p>

---

## When to use BoltzYML

Use this tool **only** if you want to study how the interaction between **two proteins changes in the presence of a ligand**.

That is the one scenario it is built for: a small molecule sits in a pocket of Protein 1, and you want Boltz-2 to predict how Protein 1 and Protein 2 dock together while that ligand is bound (or absent, as a control). Typical use cases:

- ABA signaling: PYR/PYL/RCAR receptor + ABA + PP2C phosphatase
- Allosteric drug screens where a ligand is expected to enable or block partner binding
- Any ternary system where the ligand sits on Protein 1 and you care about the Protein 1 ↔ Protein 2 interface

If your problem is just protein–protein docking, just protein–ligand docking, or anything that is **not** a ternary Protein 1 + Ligand + Protein 2 complex, BoltzYML will not help — write the YAML directly or use the Boltz-2 examples.

---

## What it does

You hand BoltzYML two CIF files:

| Input | Contents | Role |
| --- | --- | --- |
| `protein1_ligand.cif` | Protein 1 bound to the ligand (docked structure, e.g. AlphaFill, Glide, AutoDock) | Source of Protein 1 sequence + ligand identity + pocket residues |
| `protein1_protein2.cif` | Protein 1 together with Protein 2 (e.g. AlphaFold3 prediction) | Source of Protein 2 sequence |

BoltzYML then runs entirely in your browser (or via the CLI) and produces a single Boltz-2 v1 YAML with:

1. Protein 1 sequence on chain `A`
2. The ligand on chain `B` (with its PDB CCD code)
3. Protein 2 sequence on chain `C`
4. A `pocket` constraint listing the Protein 1 CA atoms within a cutoff of the ligand
5. An `affinity` property block targeting the ligand

That YAML is then fed straight into the Boltz-2 CLI.

---

## Two ways to run it

### 1. Web app (recommended)

Open **<https://ayushmania2002.github.io/boltzyml/>**, drop in the two CIFs, click *Generate YAML*, download the file.

Everything happens in your browser — no uploads, no server, no telemetry. Works on any modern browser, no installation required.

### 2. <a id="cli"></a>Command-line interface

Install from PyPI:

```bash
pip install boltzyml
```

Then run:

```bash
boltzyml \
    --ligand   PYL2_ABA.cif \
    --complex  PYL2_PP2C30.cif \
    --output   PYL2_ABA_PP2C30.yaml
```

Pure Python 3.10+, **zero runtime dependencies** (no `gemmi`, no `numpy`, no `pyyaml` required).

You can also clone the repo and run it as a module without installing:

```bash
git clone https://github.com/Ayushmania2002/boltzyml.git
cd boltzyml
pip install -e .
boltzyml --ligand A.cif --complex B.cif -o out.yaml
```

#### CLI options

| Flag | Description | Default |
| --- | --- | --- |
| `--ligand` | CIF with Protein 1 + Ligand | required |
| `--complex` | CIF with Protein 1 + Protein 2 | required |
| `-o, --output` | Output YAML path | `{ligand-stem}__{complex-stem}.yaml` |
| `--job-name` | Job name used for the default output filename | derived |
| `--cutoff` | CA-to-ligand distance cutoff in Å | `6.0` |
| `--ccd` | Override the ligand CCD code (used verbatim in the YAML's `ccd:` field) | auto-detect |
| `--no-affinity` | Skip the affinity prediction block | off |
| `--no-pocket` | Skip the pocket constraints block | off |
| `--no-force` | Emit `force: false` on the pocket block | off |
| `-v, --verbose` | Print detected chains, ligand, and contacts | off |

---

## <a id="how-it-works"></a>How it works

1. **Parse both CIFs.** The parser handles two layouts seen in the wild: single-line atom records (AlphaFold3 style, 18 fields per line) and two-line records (some AlphaFill outputs, 21 fields split 17 + 4).
2. **Identify the ligand.** The first non-water HETATM whose comp ID is not a standard amino acid is taken as the ligand. If the CIF labels it generically (`LIG`, `UNL`, `UNK`), the tool warns and asks for a CCD override.
3. **Assign chains.** Protein 1 = the longest protein chain in the ligand CIF. The corresponding chain in the complex CIF is matched by 5-mer overlap similarity; the remaining chain is Protein 2.
4. **Compute pocket contacts.** CA atoms of Protein 1 within `--cutoff` Å of any ligand atom are emitted as `[A, residue_number]` entries, using the CIF's `auth_seq_id` so the numbers match Boltz-2's own residue numbering.
5. **Emit YAML.** A deterministic Boltz-2 v1 YAML is written out, in the field order Boltz-2 expects.

> **Why CA-only at 6 Å?** CA-to-ligand at 6 Å approximates all-atom contacts at ~4 Å, which is the right scale for the soft pocket constraint Boltz-2 applies as an inference-time potential.

---

## Example output

```yaml
version: 1
sequences:
  - protein:
      id: A
      sequence: MEAHVERALREGLTEEERAALEPAVMAHHTFPPSTTTATTAAATCTSLVTQRVAAPVRAVWPIVRSFGNPQRYKHFVRTCALAAGDGASVGSVREVTVVSGLPASTSTERLEMLDDDRHIISFRVVGGQHRLRNYRSVTSVTEFQPPAAGPAPAPPYCVVVESYVVDVPDGNTAEDTRMFTDTVVKLNLQKLAAVAEDSSSASRRRD
  - ligand:
      id: B
      ccd: A8S
  - protein:
      id: C
      sequence: MAEICCEVVAGSSSEGKGPECDTGSRAARRRR...
constraints:
  - pocket:
      binder: B
      contacts:
        - [A, 76]    # PHE76
        - [A, 98]    # VAL98
        - [A, 103]   # PRO103
        - [A, 104]   # ALA104
        - [A, 107]   # SER107
        - [A, 130]   # HIS130
        - [A, 131]   # ARG131
        - [A, 132]   # LEU132
        - [A, 181]   # THR181
        - [A, 184]   # VAL184
        - [A, 185]   # VAL185
      max_distance: 6.0
      force: true
properties:
  - affinity:
      binder: B
```

---

## Running Boltz-2 on the output

```bash
pip install boltz

boltz predict job.yaml \
    --use_msa_server \
    --use_potentials \
    --diffusion_samples 3 \
    --recycling_steps  3 \
    --step_scale       1.638
```

Key result files:

| File | Contents |
| --- | --- |
| `*_model_0.pdb` | Predicted ternary structure |
| `confidence_*.json` | `iptm`, `ptm`, `ligand_iptm` |
| `affinity_*.json` | `affinity_pred_value` in kcal/mol |
| `pae_*.npz` | Predicted aligned error matrix |

Sanity checks:

- `iptm > 0.6` — confident protein–protein interface
- `ligand_iptm > 0.5` — confident ligand placement
- A low off-diagonal block between chain `A` and chain `C` in the PAE map = confident interaction

---

## Project layout

```
boltzyml/
├── index.html              # Web app (deploy to GitHub Pages as-is)
├── logo.png                # Wordmark — favicon + header logo
├── banner.png              # Pipeline schematic — used in this README
│
├── pyproject.toml          # PyPI packaging metadata (hatchling)
├── LICENSE                 # MIT
│
├── src/boltzyml/
│   ├── __init__.py         # Public API re-exports
│   ├── cli.py              # CLI entry point (boltzyml command)
│   ├── parser.py           # CIF parser (1-line and 2-line layouts)
│   ├── contacts.py         # CA-to-ligand pocket contact computation
│   ├── utils.py            # Chain assignment via k-mer similarity
│   └── yaml_writer.py      # Boltz-2 v1 YAML emitter
│
└── tests/
    ├── test_parser.py      # Synthetic CIFs for both layouts
    ├── test_contacts.py    # Cutoff filtering, missing ligand, chain remap
    └── test_cli.py         # End-to-end CLI smoke test
```

---

## Tests

```bash
pip install -e ".[dev]"
pytest
```

Or run each file directly without pytest:

```bash
python tests/test_parser.py
python tests/test_contacts.py
python tests/test_cli.py
```

Each script exits non-zero on failure and prints `all tests passed` otherwise.

---

## Gotchas

- **`LIG` / `UNL` / `UNK` ligands.** Docking tools often name the ligand generically. The real PDB CCD code (e.g. `A8S` for abscisic acid, `ATP`, `HEM`) belongs in the `ccd:` field — use the CCD override in the web app or `--ccd` on the CLI. Verify codes at <https://www.rcsb.org/ligand/>.
- **Residue numbering.** Boltz-2 uses `auth_seq_id` from your CIF. If your CIF starts at residue 14 (truncated structure), the pocket numbers will start at 14 too — that is correct.
- **Apo vs holo Protein 1.** For the ligand CIF, use the **holo** (ligand-bound) structure, not the apo AlphaFold prediction, so the pocket is in the right conformation.
- **Tamarind Bio users.** The same YAML works on <https://app.tamarind.bio/boltz>. Do **not** include a `templates:` block when submitting there — use Tamarind's UI fields for template CIFs instead.

---

## Citation

If you use BoltzYML in published or shared work, please cite **both** of the following.

**1. BoltzYML** (this tool):

> Mallick, A. *BoltzYML: a preprocessing-file generator for Boltz-2 ternary (Protein 1 + Ligand + Protein 2) binding prediction.* Zenodo (2026). <https://doi.org/10.5281/zenodo.20397272>

BibTeX:

```bibtex
@software{boltzyml_2026,
  author    = {Mallick, Ayushman},
  title     = {{BoltzYML}: a preprocessing-file generator for Boltz-2 ternary
               (Protein 1 + Ligand + Protein 2) binding prediction},
  year      = {2026},
  publisher = {Zenodo},
  version   = {1.0.0},
  doi       = {10.5281/zenodo.20397272},
  url       = {https://doi.org/10.5281/zenodo.20397272}
}
```

**2. Boltz-2** (the upstream model BoltzYML produces input for):

> Wohlwend, J. et al. *Boltz-2: Towards Accurate and Efficient Binding Affinity Prediction.* 2024. <https://github.com/jwohlwend/boltz>

---

## License

[MIT](LICENSE). Copyright © 2026 Ayushman Mallick.
