Metadata-Version: 2.4
Name: riot_na
Version: 4.0.7
Classifier: Programming Language :: Rust
Classifier: Programming Language :: Python :: Implementation :: CPython
Requires-Dist: biopython==1.84
Requires-Dist: blosum~=2.0
Requires-Dist: click~=8.1
Requires-Dist: psutil~=5.9
Requires-Dist: python-dotenv~=1.0
Requires-Dist: scikit-bio==0.6.2
Requires-Dist: scipy~=1.9
Requires-Dist: tqdm~=4.66
Requires-Dist: cachetools>=5.5.2,<6.0.0
License-File: LICENSE.txt
Summary: Antibody numbering software
Author: NaturalAntibody
Requires-Python: >=3.10, <4.0
Description-Content-Type: text/markdown; charset=UTF-8; variant=GFM
Project-URL: Homepage, https://github.com/NaturalAntibody/riot_na

# RIOT - Rapid Immunoglobulin Overview Tool

Have some raw antibody sequences? Find matching germlines, perform numbering and get results in a familiar AIRR format!

RIOT supports both nucleotide and amino acid sequences as well as all major schemes: KABAT, CHOTHIA, MARTIN and IMGT.

<details>
  <summary>MOTIVATION</summary>

Antibodies are a cornerstone of the immune system, playing a pivotal role in identifying and neutralizing infections caused by bacteria, viruses, and other pathogens. Understanding their structure, function, can provide insights into both the body's natural defenses and the principles behind many therapeutic interventions, including vaccines and antibody-based drugs. The analysis and annotation of antibody sequences, including the identification of variable, diversity, joining, and constant genes, as well as the delineation of framework regions and complementarity determining regions, are essential for understanding their structure and function. Currently analyzing large volumes of antibody sequences for is routine in antibody discovery, requiring fast and accurate tools. While there are existing tools designed for the annotation and numbering of antibody sequences, they often have limitations such as being restricted to either nucleotide or amino acid sequences, reliance on non-uniform germline databases, or slow execution times. Here we present Rapid Immunoglobulin Overview Tool (RIOT), a novel open source solution for antibody numbering that addresses these shortcomings. RIOT handles nucleotide and amino acid sequence processing, comes with a free germline database, and is computationally efficient. We hope the tool will facilitate rapid annotation of antibody sequencing outputs for the benefit of understanding of antibody biology and discovering novel therapeutics.

</details>

## Links:
- [PyPI](https://pypi.org/project/riot-na/)
- [Source code](https://github.com/NaturalAntibody/riot_na)
- [Collab example](https://colab.research.google.com/drive/1xKO4udsX5gmnY88eDKWsQaUnHsLuFwVA?usp=sharing)

## Requirements
 - Python ^3.10
 - C compiler (reason: `scikit-bio`)

## Quickstart
```
> pip install riot-na

> riot_na -s GGGCGTTTTGGCAC...

{
    "sequence_header": "-",
    "sequence": "GGGCGTTTTGGCAC...",
    "numbering_scheme": "imgt",
    "locus": "igh",
    "stop_codon": False,
    "vj_in_frame": True,
    "v_frameshift": False,
    "j_frameshift": False,
    "productive": True,
    "rev_comp": False,
    "complete_vdj": True,
    "v_call": "IGHV1-69*01",
    "d_call": "IGHD3-3*01",
    "j_call": "IGHJ6*02",
    "c_call": "IGHM",
    "v_frame": 0,
    ...
}
```

## Installation

Riot is distributed in prebuild binary wheels for all major platforms. Just run in your chosen virtualenv:

```
pip install riot-na
```

## Usage
### CLI

```
Usage: riot_na [OPTIONS]

Options:
  -f, --input-file PATH           Path to input FASTA file.
  -s, --sequence TEXT             Input sequence.
  -o, --output-file PATH          Path to output CSV file. If not specified,
                                  stdout is used.
  --scheme [KABAT|CHOTHIA|IMGT|MARTIN]
                                  Which numbering scheme should be used: IMGT,
                                  KABAT, CHOTHIA, MARTIN. Default IMGT
  --species [HOMO_SAPIENS|MUS_MUSCULUS|CUSTOM]
                                  Which species germline sequences should be
                                  used. Default is all species.
  --input-type [NT|AA]            What kind of sequences are provided on
                                  input. Default is nucleotide sequences.
  -p, --ncpu INTEGER              Number of parallel processes to use. Default
                                  is number of physical cores.
  -e, --extend_alignment BOOLEAN  Include unaligned beginning of the query
                                  sequence in numbering.This option impacts
                                  only amino acid sequences passed with -s option.
  --multiple-domains BOOLEAN      Return all domains of multiple domain
                                  proteins.
  --help                          Show this message and exit.

```

#### Examples:
Run on single sequence and print output to stdout:
```
riot_na -s <sequence>
```
Run on single sequence and save output to csv:
```
riot_na -s <sequence> -o result.csv
```
Run on fasta file:
```
riot_na -f input.fasta -o results.csv
```
### API Nucleotides

```python
from riot_na import create_riot_nt, Organism, Scheme, RiotNumberingNT, AirrRearrangementEntryNT

riot_nt: RiotNumberingNT = create_riot_nt(allowed_species = (Organism.HOMO_SAPIENS,))
airr_result: AirrRearrangementEntryNT = riot_nt.run_on_sequence(
                    header = "SRR13857054.957936",
                    query_sequence = "GAACCAAACTGACTGTCCTAGGCCAGCCCAAGTCTTCGCCATCAGTCACCCTGTTTCCACCTTCCCCTGAAGAGCTAAAAAAA",
                    scheme = Scheme.KABAT
                )
```

### API Amino Acids

```python
from riot_na import create_riot_aa, Organism, Scheme, RiotNumberingAA, AirrRearrangementEntryAA

riot_aa: RiotNumberingAA = create_riot_aa(allowed_species = (Organism.HOMO_SAPIENS,))
airr_result: AirrRearrangementEntryAA = riot_aa.run_on_sequence(
                    header = "SRR13385915.5101835",
                    query_sequence = "QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPGDTATYYCARRGGTIFGVVIILVRRPPL",
                    scheme = Scheme.KABAT,
                    extend_alignment = True
                )
```

### Caching
We provide two cached wrappers for `create_riot_nt()` and `crate_riot_aa()` functions - `get_or_create_riot_nt()` | `get_or_create_riot_aa()`. They can be used exactly the same way as base functions:

```python
from riot_na import get_or_create_riot_aa, Organism, Scheme, RiotNumberingAA, AirrRearrangementEntryAA

riot_aa: RiotNumberingAA = get_or_create_riot_aa(allowed_species = (Organism.HOMO_SAPIENS,))
airr_result: AirrRearrangementEntryAA = riot_aa.run_on_sequence(
                    header = "SRR13385915.5101835",
                    query_sequence = "QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPGDTATYYCARRGGTIFGVVIILVRRPPL",
                    scheme = Scheme.KABAT,
                    extend_alignment = True
                )
```


### Multiprocessing
Riot uses precompiled Rust module for prefiltering. This means the RiotNumberingNT/AA objects are unpickable, so you cannot pass it as a worker's parameter in eg. `mp.Pool()` or use it in Spark's UDF functions. This is achievable by using cached wrappers we provide `get_or_create_riot_nt()` | `get_or_create_riot_aa()`. Below you can find working and not working examples.

The following will not work:

```python
import functools
import multiprocessing as mp
from riot_na import create_riot_aa, AirrRearrangementEntryAA, RiotNumberingAA

seqs = ["EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGGSFYYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGHHHHHHHHG"] * 10

def worker(riot: RiotNumberingAA, seq: str) -> AirrRearrangementEntryAA:
    airr = riot.run_on_sequence("-", seq)
    return airr

riot = create_riot_aa()

worker_partial = functools.partial(worker, riot)

with mp.Pool() as pool:
    res = pool.map(worker_partial, seqs)

# Output: TypeError: cannot pickle 'builtins.Prefiltering' object
```
The proper way:
```python
import multiprocessing as mp
from riot_na import get_or_create_riot_aa, AirrRearrangementEntryAA

seqs = ["EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGGSFYYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGHHHHHHHHG"] * 10


def worker(seq: str) -> AirrRearrangementEntryAA:
    riot = get_or_create_riot_aa()
    airr = riot.run_on_sequence("-", seq)
    return airr

with mp.Pool() as pool:
    res = pool.map(worker, seqs)
```

Spark UDF example:

```python
import json
from pyspark.sql import SparkSession
from pyspark.sql.functions import udf
from cachetools import cached
from riot_na import get_or_create_riot_aa, RiotNumberingAA

spark = SparkSession.builder.appName("Riot on Spark").getOrCreate()

seq = "EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGGSFYYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGHHHHHHHHG"

df = spark.createDataFrame([{"seq":  seq}]*10)

@udf
def number_sequence(seq: str)-> str:
    riot = get_or_create_riot_aa()
    airr = riot.run_on_sequence("-", seq)
    return json.dumps(airr.__dict__)

df.select(number_sequence("seq")).collect()
```

For a pure Python solution (without the use of `cachetools` package) you can check `riot_na/api/api_mp.py` file.


## Multidomains support
RIOT's multidomains support allows detection and numbering of multiple immunoglobulin domains within a single protein sequence, such as therapeutic antibodies containing both heavy chain (VH) and light chain (VL) domains. When enabled with the --multiple-domains flag (or return_all_domains=True in the API), RIOT returns separate numbering results for each detected domain rather than just the best single match. The system automatically identifies domain boundaries, truncates sequences at the beginning of each V gene segment, and provides additional metadata including the original query sequence and segment start/end positions for each domain. This is particularly useful for analyzing therapeutic constructs like bispecific antibodies, CAR-T constructs, or other multi-domain fusion proteins where each immunoglobulin domain needs independent numbering and analysis.

## Germline database
RIOT uses OGRDB as a primary source of germline alleles. Database version as of 22.01.2024 was used.
C genes are imported from igblast FTP site fhttps://ftp.ncbi.nih.gov/blast/executables/igblast/release/database/ncbi_human_c_genes.tar


## Data format

This section describes the fields of numbering result object AirrRearrangementEntry(AA). It is based on AIRR Rearrangement Schema format extended by 7 columns highlighted in the table (bold) and emptied of the unnecessary ones. There are also some differences in fields’ definitions, so the AIRR format specification should be treated only as a loose reference. Description of the original AIRR format can be found [here](https://docs.airr-community.org/en/stable/datarep/rearrangements.html#fields).


Attributes:


1. All fields in the format are required (always present)
2. All fields are nullable, with the exception of _sequence_header_ and _sequence_

### AirrRearrangementNT fields definitions

| Name                            | Type                                        | Definition                                                                                                                                                                                                                                                                                                                                                                                       |
| :------------------------------ | :------------------------------------------ | :----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| sequence_header                 | string                                      | Fasta header for given input sequence (when numbering a FASTA file) or value of sequence_header parameter (when using RiotNumberingNT API).                                                                                                                                                                                                                                                      |
| sequence                        | string                                      | The segment nucleotide sequence. May be truncated to the beginning of v_gene when --multiple-domains flag is enabled                                                                                                                                                                                                                                                                             |
| sequence_aa                     | string                                      | Translated query sequence.                                                                                                                                                                                                                                                                                                                                                                       |
| numbering_scheme                | enum ["imgt", "kabat", "chothia", "martin"] | Used numbering scheme, default is "imgt".                                                                                                                                                                                                                                                                                                                                                        |
| locus                           | string                                      | Gene locus (chain type).                                                                                                                                                                                                                                                                                                                                                                         |
| locus_species                   | string                                      | Binomial designation of the species from which the locus originates.                                                                                                                                                                                                                                                                                                                             |
| stop_codon                      | boolean                                     | True if the aligned sequence contains a stop codon.                                                                                                                                                                                                                                                                                                                                              |
| vj_in_frame                     | boolean                                     | True if the V and J gene alignments are in-frame.  In details: distance between v_alignement reading frame and j_alignment reading frame is divisible by 3.                                                                                                                                                                                                                                      |
| v_frameshift                    | boolean                                     | True if the V gene in the query nucleotide sequence contains a translational frameshift relative to the frame of the V gene reference sequence. In other words: sum of insertions and deletions between consecutive matches in alignment is divisible by 3.                                                                                                                                      |
| j_frameshift                    | boolean                                     | True if the J gene in the query nucleotide sequence contains a translational frameshift relative to the frame of the J gene reference sequence.  In other words: sum of insertions and deletions between consecutive matches in alignment is divisible by 3.                                                                                                                                     |
| productive                      | boolean                                     | True if the V(D)J sequence is predicted to be productive.  In details: stop_codon is False and vj_in_frame is True                                                                                                                                                                                                                                                                               |
| rev_comp                        | boolean                                     | True if the alignment is on the opposite strand (reverse complemented) with respect to the query sequence. If True, indicates the sequence field contains a reverse complemented original query sequence.                                                                                                                                                                                        |
| complete_vdj                    | boolean                                     | True if the sequence alignment spans the entire V(D)J region. Meaning, sequence_alignment includes both the first V gene codon that encodes the mature polypeptide chain (i.e., after the leader sequence) and the last complete codon of the J gene (i.e., before the J-C splice site). This does not require an absence of deletions within the internal FWR and CDR regions of the alignment. |
| v_call                          | string                                      | V gene with allele.                                                                                                                                                                                                                                                                                                                                                                              |
| d_call                          | string                                      | D gene with allele.                                                                                                                                                                                                                                                                                                                                                                              |
| j_call                          | string                                      | J gene with allele.                                                                                                                                                                                                                                                                                                                                                                              |
| c_call                          | string                                      | Constant region gene with allele.                                                                                                                                                                                                                                                                                                                                                                |
| **v_frame**                     | enum [0, 1, 2]                              | V frame offset from v_alignment_start.                                                                                                                                                                                                                                                                                                                                                           |
| **j_frame**                     | enum [0, 1, 2]                              | J frame offset from j_alignment_start.                                                                                                                                                                                                                                                                                                                                                           |
| sequence_alignment              | string                                      | Gapped alignment of query sequence spanning V-J segment aligned to germline, reverse complemented if needed.                                                                                                                                                                                                                                                                                     |
| germline_alignment              | string                                      | Gapped aligned germline sequence spanning the same region as the sequence_alignment field (V(D)J region). Segments between matched germlines are gapped to match query sequence length.                                                                                                                                                                                                          |
| sequence_alignment_aa           | string                                      | Amino acid translation of the sequence_alignment.                                                                                                                                                                                                                                                                                                                                                |
| germline_alignment_aa           | string                                      | Amino acid translation of the germline_alignment.                                                                                                                                                                                                                                                                                                                                                |
| v_alignment_start               | integer                                     | Start position of the V gene alignment in sequence_alignment (1-based closed interval).                                                                                                                                                                                                                                                                                                          |
| v_alignment_end                 | integer                                     | End position of the V gene alignment in sequence_alignment (1-based closed interval).                                                                                                                                                                                                                                                                                                            |
| d_alignment_start               | integer                                     | Start position of the D gene alignment in sequence_alignment (1-based closed interval).                                                                                                                                                                                                                                                                                                          |
| d_alignment_end                 | integer                                     | End position of the D gene alignment in sequence_alignment (1-based closed interval).                                                                                                                                                                                                                                                                                                            |
| j_alignment_start               | integer                                     | Start position of the J gene alignment in sequence_alignment (1-based closed interval).                                                                                                                                                                                                                                                                                                          |
| j_alignment_end                 | integer                                     | End position of the J gene alignment in sequence_alignment (1-based closed interval).                                                                                                                                                                                                                                                                                                            |                                                                                                                                                                                                                                                                                                          |
| v_sequence_alignment            | string                                      | Aligned portion of query sequence assigned to the V gene.                                                                                                                                                                                                                                                                                                                                        |
| v_sequence_alignment_aa         | string                                      | Amino acid translation of the v_sequence_alignment field.                                                                                                                                                                                                                                                                                                                                        |
| v_germline_alignment            | string                                      | Aligned V gene germline sequence.                                                                                                                                                                                                                                                                                                                                                                |
| v_germline_alignment_aa         | string                                      | Aligned amino acid V gene germline sequence.                                                                                                                                                                                                                                                                                                                                                     |
| d_sequence_alignment            | string                                      | Aligned portion of query sequence assigned to the D gene.                                                                                                                                                                                                                                                                                                                                        |
| d_germline_alignment            | string                                      | Aligned D gene germline sequence.                                                                                                                                                                                                                                                                                                                                                                |
| j_sequence_alignment            | string                                      | Aligned portion of query sequence assigned to the J gene.                                                                                                                                                                                                                                                                                                                                        |
| j_sequence_alignment_aa         | string                                      | Amino acid translation of the j_sequence_alignment field.                                                                                                                                                                                                                                                                                                                                        |
| j_germline_alignment            | string                                      | Aligned J gene germline sequence.                                                                                                                                                                                                                                                                                                                                                                |
| j_germline_alignment_aa         | string                                      | Aligned amino acid J gene germline sequence.                                                                                                                                                                                                                                                                                                                                                     |
| c_sequence_alignment            | string                                      | Aligned portion of query sequence assigned to the constant region.                                                                                                                                                                                                                                                                                                                               |
| c_germline_alignment            | string                                      | Aligned constant region germline sequence.                                                                                                                                                                                                                                                                                                                                                       |
| fwr1                            | string                                      | Nucleotide sequence of the aligned FWR1 region.                                                                                                                                                                                                                                                                                                                                                  |
| fwr1_aa                         | string                                      | Amino acid translation of the fwr1 field.                                                                                                                                                                                                                                                                                                                                                        |
| cdr1                            | string                                      | Nucleotide sequence of the aligned CDR1 region.                                                                                                                                                                                                                                                                                                                                                  |
| cdr1_aa                         | string                                      | Amino acid translation of the cdr1 field.                                                                                                                                                                                                                                                                                                                                                        |
| fwr2                            | string                                      | Nucleotide sequence of the aligned FWR2 region.                                                                                                                                                                                                                                                                                                                                                  |
| fwr2_aa                         | string                                      | Amino acid translation of the fwr2 field.                                                                                                                                                                                                                                                                                                                                                        |
| cdr2                            | string                                      | Nucleotide sequence of the aligned CDR2 region.                                                                                                                                                                                                                                                                                                                                                  |
| cdr2_aa                         | string                                      | Amino acid translation of the cdr2 field.                                                                                                                                                                                                                                                                                                                                                        |
| fwr3                            | string                                      | Nucleotide sequence of the aligned FWR3 region.                                                                                                                                                                                                                                                                                                                                                  |
| fwr3_aa                         | string                                      | Amino acid translation of the fwr3 field.                                                                                                                                                                                                                                                                                                                                                        |
| cdr3                            | string                                      | Nucleotide sequence of the aligned CDR3 region.                                                                                                                                                                                                                                                                                                                                                  |
| cdr3_aa                         | string                                      | Amino acid translation of the cdr3 field.                                                                                                                                                                                                                                                                                                                                                        |
| fwr4                            | string                                      | Nucleotide sequence of the aligned FWR4 region.                                                                                                                                                                                                                                                                                                                                                  |
| fwr4_aa                         | string                                      | Amino acid translation of the fwr4 field.                                                                                                                                                                                                                                                                                                                                                        |
| junction                        | string                                      | Junction region nucleotide sequence, where the junction is defined as the CDR3 plus the two flanking conserved codons.                                                                                                                                                                                                                                                                           |
| junction_aa                     | string                                      | Amino acid translation of the junction.                                                                                                                                                                                                                                                                                                                                                          |
| junction_length                 | integer                                     | Number of nucleotides in the junction sequence.                                                                                                                                                                                                                                                                                                                                                  |
| junction_aa_length              | integer                                     | Number of amino acids in the junction sequence.                                                                                                                                                                                                                                                                                                                                                  |
| v_score                         | number                                      | Alignment score (Smith-Waterman) for the V gene.                                                                                                                                                                                                                                                                                                                                                 |
| d_score                         | number                                      | Alignment score (Smith-Waterman) for the D gene alignment.                                                                                                                                                                                                                                                                                                                                       |
| j_score                         | number                                      | Alignment score (Smith-Waterman) for the J gene alignment.                                                                                                                                                                                                                                                                                                                                       |
| c_score                         | number                                      | Alignment score (Smith-Waterman) for the C gene alignment.                                                                                                                                                                                                                                                                                                                                       |
| v_cigar                         | string                                      | CIGAR string for the V gene alignment.                                                                                                                                                                                                                                                                                                                                                           |
| d_cigar                         | string                                      | CIGAR string for the D gene alignment.                                                                                                                                                                                                                                                                                                                                                           |
| j_cigar                         | string                                      | CIGAR string for the J gene alignment.                                                                                                                                                                                                                                                                                                                                                           |
| c_cigar                         | string                                      | CIGAR string for the C gene alignment.                                                                                                                                                                                                                                                                                                                                                           |
| v_support                       | number                                      | V gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)                                                                                                                                                                                                                                                    |
| d_support                       | number                                      | D gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)                                                                                                                                                                                                                                                    |
| j_support                       | number                                      | J gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)                                                                                                                                                                                                                                                    |
| c_support                       | number                                      | C gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)                                                                                                                                                                                                                                                    |
| v_identity                      | number                                      | Fractional identity for the V gene alignment.                                                                                                                                                                                                                                                                                                                                                    |
| d_identity                      | number                                      | Fractional identity for the D gene alignment.                                                                                                                                                                                                                                                                                                                                                    |
| j_identity                      | number                                      | Fractional identity for the J gene alignment.                                                                                                                                                                                                                                                                                                                                                    |
| c_identity                      | number                                      | Fractional identity for the C gene alignment.                                                                                                                                                                                                                                                                                                                                                    |
| v_sequence_start                | integer                                     | Start position of the V gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                    |
| v_sequence_end                  | integer                                     | End position of the V gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                      |
| d_sequence_start                | integer                                     | Start position of the D gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                    |
| d_sequence_end                  | integer                                     | End position of the D gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                      |
| j_sequence_start                | integer                                     | Start position of the J gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                    |
| j_sequence_end                  | integer                                     | End position of the J gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                      |
| c_sequence_start                | integer                                     | Start position of the C gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                    |
| c_sequence_end                  | integer                                     | End position of the C gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                      |
| v_germline_start                | integer                                     | Alignment start position in the V gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                             |
| v_germline_end                  | integer                                     | Alignment end position in the V gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                               |
| d_germline_start                | integer                                     | Alignment start position in the D gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                             |
| d_germline_end                  | integer                                     | Alignment end position in the D gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                               |
| j_germline_start                | integer                                     | Alignment start position in the J gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                             |
| j_germline_end                  | integer                                     | Alignment end position in the J gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                               |
| c_germline_start                | integer                                     | Alignment start position in the C gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                             |
| c_germline_end                  | integer                                     | Alignment end position in the C gene reference sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                               |
| fwr1_start                      | integer                                     | FWR1 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| fwr1_end                        | integer                                     | FWR1 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| cdr1_start                      | integer                                     | CDR1 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| cdr1_end                        | integer                                     | CDR1 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| fwr2_start                      | integer                                     | FWR2 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| fwr2_end                        | integer                                     | FWR2 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| cdr2_start                      | integer                                     | CDR2 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| cdr2_end                        | integer                                     | CDR2 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| fwr3_start                      | integer                                     | FWR3 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| fwr3_end                        | integer                                     | FWR3 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| cdr3_start                      | integer                                     | CDR3 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| cdr3_end                        | integer                                     | CDR3 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| fwr4_start                      | integer                                     | FWR4 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                             |
| fwr4_end                        | integer                                     | FWR4 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                                                                                                               |
| **sequence_aa_scheme_cigar**    | string                                      | CIGAR string defining sequence_aa to scheme alignment.                                                                                                                                                                                                                                                                                                                                           |
| **scheme_residue_mapping**      | json string                                 | Scheme numbering of sequence_alignment_aa - positions not present in this sequence are not included.                                                                                                                                                                                                                                                                                             |
| **positional_scheme_mapping**   | json string                                 | Mapping from absolute residue position in sequence_alignment_aa (0-based) to corresponding scheme position.                                                                                                                                                                                                                                                                                      |
| **exc**                         | string                                      | Exception (if any) thrown during ANARCI numbering.                                                                                                                                                                                                                                                                                                                                               |
| **additional_validation_flags** | json string                                 | JSON string containing additional validation flags.                                                                                                                                                                                                                                                                                                                                              |
| query_sequence                  | string                                      | The query sequence. (Optional: only available with --multiple-domains flag enabled)                                                                                                                                                                                                                                                                                                              |
| segment_start                   | integer                                     | Start position of the segment in query_sequence (1-based closed interval). (Optional: only available with --multiple-domains flag enabled)                                                                                                                                                                                                                                                       |
| segment_end                     | integer                                     | End position of the segment in query_sequence (1-based closed interval).  (Optional: only available with --multiple-domains flag enabled)                                                                                                                                                                                                                                                        |




#### Additional validation flags

Following table describes additional validation flags calculated alongside main fields. Last 5 flags regarding conserved residues apply only then using IMGT schema.

| Field name                                | AIRR fields required for calculation                                                                                     | Description                                                                                                                                                                       |
| :---------------------------------------- | :----------------------------------------------------------------------------------------------------------------------- | :-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| regions_in_aligned_sequence               | all regions (fwr1, cdr1, fwr2 …); sequence_alignment                                                                     | True if all region sequences, concatenated, are present in sequence_alignment.                                                                                                    |
| regions_aa_in_aligned_sequence_aa         | all <region>_aa (fwr1_aa, cdr1_aa, …); sequence_alignment_aa                                                             | True if all region_aa sequences, concatenated, are present in sequence_alignment_aa.                                                                                              |
| translated_regions_in_aligned_sequence_aa | all regions (fwr1, cdr1, fwr2 …); sequence_alignment_aa; v_frame                                                         | True if all region sequences, concatenated and translated using v_frame, are present in sequence_alignment_aa.                                                                    |
| correct_vj_in_frame                       | v_alignment_start; v_frame; j_alignment_start; j_frame                                                                   | True if vj_in_frame is equal to: distance between v_alignement translation frame and j_alignment translation frame is divisible by 3.                                             |
| cdr3_in_junction                          | cdr3; junction; cdr3_aa; junction_aa                                                                                     | True if cdr3 is present in junction and cdr3_aa is present in junction_aa.                                                                                                        |
| locus_as_in_v_gene                        | locus; v_call                                                                                                            | True if locus is consistent with the one specified in V gene (v_call).                                                                                                            |
| v_gene_alignment                          | sequence; v_sequence_start; v_sequence_end; v_sequence_alignment                                                         | True if v_sequence_alignment is equal to substring in sequence from position v_sequence_start to v_sequence_end.                                                                  |
| j_gene_alignment                          | sequence; j_sequence_start; j_sequence_end; j_sequence_alignment                                                         | True if j_sequence_alignment is equal to substring in sequence from position j_sequence_start to j_sequence_end.                                                                  |
| c_gene_alignment                          | sequence; c_sequence_start; c_sequence_end; c_sequence_alignment                                                         | True if c_sequence_alignment is equal to substring in sequence from position c_sequence_start to c_sequence_end.                                                                  |
| no_negative_offsets_inside_v_alignment    | fwr1_start; fwr1_end; cdr1_start; cdr1_end; fwr2_start; fwr2_end; cdr2_start; cdr2_end; fwr3_start; fwr3_end; cdr3_start | True if there is no negative (missing) offset inside V alignment, eg.: fwr1_start == 1; fwr1_end == 35; cdr1_start == -1; cdr1_end == 65.                                         |
| no_negative_offsets_inside_j_alignment    | cdr3_end; fwr4_start; fwr4_end                                                                                           | True if there is no negative (missing) offset inside J alignment, eg.: cdr3_end == 293; fwr4_start == -1; fwr4_end == 326.                                                        |
| consecutive_offsets                       | all <region>_start and <region>_end                                                                                      | True if consecutive region_start and region_end offsets are ascendant, and no region_start is greater than corresponding region_end.                                              |
| no_empty_cdr3                             | cdr3                                                                                                                     | True if cdr3 is present.                                                                                                                                                          |
| primary_sequence_in_sequence_alignment_aa | sequence_alignment_aa; scheme_residue_mapping                                                                            | True if concatenation of scheme_residue_mapping amino acids results in a sequence that is a part of sequence_alignment_aa and amino acids are in correct order.                   |
| no_insertion_next_to_deletion_aa          | sequence_aa_scheme_cigar                                                                                                 | True if there are no insertions next to deletions - indicates correct CIGARs merging process.                                                                                     |
| insertions_in_correct_places              | scheme_residue_mapping; numbering_scheme; locus                                                                          | True if insertions are on schema-allowed positions.                                                                                                                               |
| correct_fwr1_offsets                      | sequence; v_sequence_start; fwr1_start; fwr1_end; fwr1                                                                   | True if fwr1 is equal to substring in sequence cut from position fwr1_start up to fwr1_end. If fwr1_start is -1 (missing), v_sequence_start is used as a starting offset instead. |
| correct_cdr1_offsets                      | sequence; cdr1_start; cdr1_end; cdr1                                                                                     | True if cdr1 is equal to substring in sequence cut from position cdr1_start up to cdr1_end.                                                                                       |
| correct_fwr2_offsets                      | sequence; fwr2_start; fwr2_end; fwr2                                                                                     | True if fwr2 is equal to substring in sequence cut from position fwr2_start up to fwr2_end.                                                                                       |
| correct_cdr2_offsets                      | sequence; cdr2_start; cdr2_end; cdr2                                                                                     | True if cdr2 is equal to substring in sequence cut from position cdr2_start up to cdr2_end.                                                                                       |
| correct_fwr3_offsets                      | sequence; fwr3_start; fwr3_end; fwr3                                                                                     | True if fwr3 is equal to substring in sequence cut from position fwr3_start up to fwr3_end.                                                                                       |
| correct_cdr3_offsets                      | sequence; cdr3_start; cdr3_end; cdr3                                                                                     | True if cdr3 is equal to substring in sequence cut from position cdr3_start up to cdr3_end.                                                                                       |
| correct_fwr4_offsets                      | sequence; j_sequence_end; fwr4_start; fwr4_end; fwr4                                                                     | True if fwr4 is equal to substring in sequence cut from position fwr4_start up to fwr4_end. If fwr4_end is -1 (missing), j_sequence_end is used as an ending offset instead.      |
| no_empty_fwr1_in_v                        | v_sequence_alignment; fwr1                                                                                               | True if fwr1 is present.                                                                                                                                                          |
| no_empty_cdr1_in_v                        | v_sequence_alignment; cdr1                                                                                               | True if cdr1 is present.                                                                                                                                                          |
| no_empty_fwr2_in_v                        | v_sequence_alignment; fwr2                                                                                               | True if fwr2 is present.                                                                                                                                                          |
| no_empty_cdr2_in_v                        | v_sequence_alignment; cdr2                                                                                               | True if cdr2 is present.                                                                                                                                                          |
| no_empty_fwr3_in_v                        | v_sequence_alignment; fwr3                                                                                               | True if fwr3 is present.                                                                                                                                                          |
| no_empty_fwr4_in_j                        | j_sequence_alignment; fwr4                                                                                               | True if fwr4 is present.                                                                                                                                                          |
| conserved_C23_present                     | imgt_residue_mapping                                                                                                     | True if conserved Cysteine on IMGT position 23 is present.                                                                                                                        |
| conserved_W41_present                     | imgt_residue_mapping                                                                                                     | True if conserved Tryptophan on IMGT position 41 is present.                                                                                                                      |
| conserved_C104_present                    | imgt_residue_mapping                                                                                                     | True if conserved Cysteine on IMGT position 104 is present.                                                                                                                       |
| conserved_W118_heavy_present              | imgt_residue_mapping                                                                                                     | True if conserved Tryptophan on IMGT position 118 is present (heavy chain only).                                                                                                  |
| conserved_F118_light_present              | imgt_residue_mapping                                                                                                     | True if conserved Phenylalanine on IMGT position 118 is present (light chain only).                                                                                               |


### AirrRearrangementAA field definitions

Airr data format was developed for nucleotide sequences. For the amino acid pipeline a similar to format was created. Most fields are analogous to nucleotide-based one, with `_aa` suffix in name.

| Name                        | Type                                        | Definition                                                                                                                                                                                                                                                                                            |
| :-------------------------- | :------------------------------------------ | :---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| sequence_header             | string                                      | Fasta header for given input sequence (when numbering a FASTA file) or value of sequence_header parameter (when using RiotNumberingNT API).                                                                                                                                                           |
| sequence_aa                 | string                                      | The query sequence. May be truncated by the detection of v_gene based segment when --multiple-domains flag is enabled.                                                                                                                                                                                |
| numbering_scheme            | enum ["imgt", "kabat", "chothia", "martin"] | Used numbering scheme, default is "imgt".                                                                                                                                                                                                                                                             |
| locus                       | string                                      | Gene locus (chain type).                                                                                                                                                                                                                                                                              |
| locus_species               | string                                      | Binomial designation of the species from which the locus originates.                                                                                                                                                                                                                                  |
| stop_codon                  | boolean                                     | True if the aligned sequence contains a stop codon.                                                                                                                                                                                                                                                   |
| productive                  | boolean                                     | True if the V(D)J sequence is predicted to be productive. In details: stop_codon is False and V and J genes are detected.                                                                                                                                                                             |
| complete_vdj                | boolean                                     | True if the sequence alignment spans the entire V(D)J region. Meaning, sequence alignment includes both the first V amino acid and the last of the J gene (i.e., before the J-C splice site). This does not require an absence of deletions within the internal FWR and CDR regions of the alignment. |
| v_call                      | string                                      | V gene with allele.                                                                                                                                                                                                                                                                                   |
| j_call                      | string                                      | J gene with allele.                                                                                                                                                                                                                                                                                   |
| germline_alignment_aa       | string                                      | Assembled, aligned, full-length inferred germline sequence spanning the same region as the sequence_alignment_aa field (V-J region).                                                                                                                                                                  |
| sequence_alignment_aa       | string                                      | Segment of query sequence spanning V-J aligned to germline.                                                                                                                                                                                                                                           |
| v_alignment_start_aa        | integer                                     | Start position of the V gene alignment in sequence_alignment_aa (1-based closed interval).                                                                                                                                                                                                            |
| v_alignment_end_aa          | integer                                     | End position of the V gene alignment in sequence_alignment_aa (1-based closed interval).                                                                                                                                                                                                              |
| j_alignment_start_aa        | integer                                     | Start position of the J gene alignment in sequence_alignment_aa (1-based closed interval).                                                                                                                                                                                                            |
| j_alignment_end_aa          | integer                                     | End position of the J gene alignment in sequence_alignment_aa (1-based closed interval).                                                                                                                                                                                                              |
| v_sequence_alignment_aa     | string                                      | Aligned portion of query sequence assigned to the V gene.                                                                                                                                                                                                                                             |
| v_germline_alignment_aa     | string                                      | Aligned V gene germline sequence.                                                                                                                                                                                                                                                                     |
| j_sequence_alignment_aa     | string                                      | Aligned portion of query sequence assigned to the J gene.                                                                                                                                                                                                                                             |
| j_germline_alignment_aa     | string                                      | Aligned J gene germline sequence.                                                                                                                                                                                                                                                                     |
| fwr1_aa                     | string                                      | Amino acid sequence of the aligned FWR1 region.                                                                                                                                                                                                                                                       |
| cdr1_aa                     | string                                      | Amino acid sequence of the aligned CDR1 region.                                                                                                                                                                                                                                                       |
| fwr2_aa                     | string                                      | Amino acid sequence of the aligned FWR2 region.                                                                                                                                                                                                                                                       |
| cdr2_aa                     | string                                      | Amino acid sequence of the aligned CDR2 region.                                                                                                                                                                                                                                                       |
| fwr3_aa                     | string                                      | Amino acid sequence of the aligned FWR3 region.                                                                                                                                                                                                                                                       |
| cdr3_aa                     | string                                      | Amino acid sequence of the aligned CDR3 region.                                                                                                                                                                                                                                                       |
| fwr4_aa                     | string                                      | Amino acid sequence of the aligned FWR4 region.                                                                                                                                                                                                                                                       |
| junction_aa                 | string                                      | Junction region nucleotide sequence, where the junction is defined as the CDR3 plus the two flanking conserved amino acids.                                                                                                                                                                           |
| junction_aa_length          | integer                                     | Number of amino acids in the junction sequence.                                                                                                                                                                                                                                                       |
| v_score_aa                  | number                                      | Alignment score (Smith-Waterman) for the V gene.                                                                                                                                                                                                                                                      |
| j_score_aa                  | number                                      | Alignment score (Smith-Waterman) for the J gene alignment.                                                                                                                                                                                                                                            |
| v_cigar_aa                  | string                                      | CIGAR string for the V gene alignment.                                                                                                                                                                                                                                                                |
| j_cigar_aa                  | string                                      | CIGAR string for the J gene alignment.                                                                                                                                                                                                                                                                |
| v_support_aa                | number                                      | V gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)                                                                                                                                                         |
| j_support_aa                | number                                      | J gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)                                                                                                                                                         |
| v_identity_aa               | number                                      | Fractional identity for the V gene alignment.                                                                                                                                                                                                                                                         |
| j_identity_aa               | number                                      | Fractional identity for the J gene alignment.                                                                                                                                                                                                                                                         |
| v_sequence_start_aa         | integer                                     | Start position of the V gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                         |
| v_sequence_end_aa           | integer                                     | End position of the V gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                           |
| j_sequence_start_aa         | integer                                     | Start position of the J gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                         |
| j_sequence_end_aa           | integer                                     | End position of the J gene in the query sequence (1-based closed interval).                                                                                                                                                                                                                           |
| v_germline_start_aa         | integer                                     | Alignment start position in the V gene reference sequence (1-based closed interval).                                                                                                                                                                                                                  |
| v_germline_end_aa           | integer                                     | Alignment end position in the V gene reference sequence (1-based closed interval).                                                                                                                                                                                                                    |
| j_germline_start_aa         | integer                                     | Alignment start position in the J gene reference sequence (1-based closed interval).                                                                                                                                                                                                                  |
| j_germline_end_aa           | integer                                     | Alignment end position in the J gene reference sequence (1-based closed interval).                                                                                                                                                                                                                    |
| fwr1_start_aa               | integer                                     | FWR1 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| fwr1_end_aa                 | integer                                     | FWR1 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| cdr1_start_aa               | integer                                     | CDR1 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| cdr1_end_aa                 | integer                                     | CDR1 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| fwr2_start_aa               | integer                                     | FWR2 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| fwr2_end_aa                 | integer                                     | FWR2 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| cdr2_start_aa               | integer                                     | CDR2 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| cdr2_end_aa                 | integer                                     | CDR2 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| fwr3_start_aa               | integer                                     | FWR3 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| fwr3_end_aa                 | integer                                     | FWR3 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| cdr3_start_aa               | integer                                     | CDR3 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| cdr3_end_aa                 | integer                                     | CDR3 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| fwr4_start_aa               | integer                                     | FWR4 start position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                  |
| fwr4_end_aa                 | integer                                     | FWR4 end position in the query sequence (1-based closed interval).                                                                                                                                                                                                                                    |
| sequence_aa_scheme_cigar    | string                                      | CIGAR string defining sequence_alignment_aa to scheme alignment.                                                                                                                                                                                                                                      |
| scheme_residue_mapping      | json string                                 | Scheme numbering of sequence_alignment_aa - positions not present in this sequence are not included.                                                                                                                                                                                                  |
| positional_scheme_mapping   | json string                                 | Mapping from absolute residue position in sequence_alignment_aa (0-based) to corresponding scheme position.                                                                                                                                                                                           |
| exc                         | string                                      | Exception (if any) thrown during ANARCI numbering.                                                                                                                                                                                                                                                    |
| additional_validation_flags | json string                                 | JSON string containing additional validation flags.                                                                                                                                                                                                                                                   |
| query_sequence              | string                                      | The query sequence. (Optional: only available with --multiple-domains flag enabled)                                                                                                                                                                                                                   |
| segment_start               | integer                                     | Start position of the segment in query_sequence (1-based closed interval). (Optional: only available with --multiple-domains flag enabled)                                                                                                                                                            |
| segment_end                 | integer                                     | End position of the segment in query_sequence (1-based closed interval).  (Optional: only available with --multiple-domains flag enabled)                                                                                                                                                             |


#### Additional validation flags (AA)
Following table describes additional validation flags calculated alongside main fields. Last 5 flags regarding conserved residues apply only then using IMGT schema.

|                                           | AIRR fields required for calculation                                                                                                                                                       | Description                                                                                                                                                                                               |
| :---------------------------------------- | :----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | :-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| regions_aa_in_aligned_sequence_aa         | all <region>_aa (fwr1_aa_aa, cdr1_aa_aa, …); sequence_alignment_aa                                                                                                                         | True if all region_aa sequences, concatenated, are present in sequence_alignment_aa.                                                                                                                      |
| locus_as_in_v_gene                        | locus; v_call                                                                                                                                                                              | True if locus is consistent with the one specified in V gene (v_call).                                                                                                                                    |
| v_gene_alignment_aa                       | sequence; v_sequence_start_aa; v_sequence_end_aa; v_sequence_alignment_aa                                                                                                                  | True if v_sequence_alignment_aa is equal to substring in sequence from position v_sequence_start_aa to v_sequence_end_aa.                                                                                 |
| j_gene_alignment_aa                       | sequence; j_sequence_start_aa; j_sequence_end_aa; j_sequence_alignment_aa                                                                                                                  | True if j_sequence_alignment_aa is equal to substring in sequence from position j_sequence_start_aa to j_sequence_end_aa.                                                                                 |
| no_negative_offsets_inside_v_alignment_aa | fwr1_aa_start_aa; fwr1_aa_end_aa; cdr1_aa_start_aa; cdr1_aa_end_aa; fwr2_aa_start_aa; fwr2_aa_end_aa; cdr2_aa_start_aa; cdr2_aa_end_aa; fwr3_aa_start_aa; fwr3_aa_end_aa; cdr3_aa_start_aa | True if there is no negative (missing) offset inside V alignment, eg.: fwr1_aa_start_aa == 1; fwr1_aa_end_aa == 26; cdr1_aa_start_aa == -1; cdr1_aa_end_aa == 38.                                         |
| no_negative_offsets_inside_j_alignment_aa | cdr3_aa_end_aa; fwr4_aa_start_aa; fwr4_aa_end_aa                                                                                                                                           | True if there is no negative (missing) offset inside J alignment, eg.: cdr3_aa_end_aa == 117; fwr4_aa_start_aa == -1; fwr4_aa_end_aa == 128.                                                              |
| consecutive_offsets_aa                    | all <region>_start_aa and <region>_end_aa                                                                                                                                                  | True if consecutive region_start_aa and region_end_aa offsets are ascendant, and no region_start_aa is greater than corresponding region_end_aa.                                                          |
| no_empty_cdr3_aa                          | cdr3_aa                                                                                                                                                                                    | True if cdr3_aa is present.                                                                                                                                                                               |
| primary_sequence_in_sequence_alignment_aa | sequence_alignment_aa; scheme_residue_mapping                                                                                                                                              | True if concatenation of scheme_residue_mapping amino acids results in a sequence that is a part of sequence_alignment_aa and amino acids are in correct order.                                           |
| no_insertion_next_to_deletion_aa          | sequence_aa_scheme_cigar                                                                                                                                                                   | True if there are no insertions next to deletions - indicates correct CIGARs merging process.                                                                                                             |
| insertions_in_correct_places              | scheme_residue_mapping; numbering_scheme; locus                                                                                                                                            | True if insertions are on schema-allowed positions.                                                                                                                                                       |
| correct_fwr1_aa_offsets                   | sequence; v_sequence_start_aa; fwr1_aa_start_aa; fwr1_aa_end_aa; fwr1_aa                                                                                                                   | True if fwr1_aa is equal to substring in sequence cut from position fwr1_aa_start_aa up to fwr1_aa_end_aa. If fwr1_aa_start_aa is -1 (missing), v_sequence_start_aa is used as a starting offset instead. |
| correct_cdr1_aa_offsets                   | sequence; cdr1_aa_start_aa; cdr1_aa_end_aa; cdr1_aa                                                                                                                                        | True if cdr1_aa is equal to substring in sequence cut from position cdr1_aa_start_aa up to cdr1_aa_end_aa.                                                                                                |
| correct_fwr2_aa_offsets                   | sequence; fwr2_aa_start_aa; fwr2_aa_end_aa; fwr2_aa                                                                                                                                        | True if fwr2_aa is equal to substring in sequence cut from position fwr2_aa_start_aa up to fwr2_aa_end_aa.                                                                                                |
| correct_cdr2_aa_offsets                   | sequence; cdr2_aa_start_aa; cdr2_aa_end_aa; cdr2_aa                                                                                                                                        | True if cdr2_aa is equal to substring in sequence cut from position cdr2_aa_start_aa up to cdr2_aa_end_aa.                                                                                                |
| correct_fwr3_aa_offsets                   | sequence; fwr3_aa_start_aa; fwr3_aa_end_aa; fwr3_aa                                                                                                                                        | True if fwr3_aa is equal to substring in sequence cut from position fwr3_aa_start_aa up to fwr3_aa_end_aa.                                                                                                |
| correct_cdr3_aa_offsets                   | sequence; cdr3_aa_start_aa; cdr3_aa_end_aa; cdr3_aa                                                                                                                                        | True if cdr3_aa is equal to substring in sequence cut from position cdr3_aa_start_aa up to cdr3_aa_end_aa.                                                                                                |
| correct_fwr4_aa_offsets                   | sequence; j_sequence_end_aa; fwr4_aa_start_aa; fwr4_aa_end_aa; fwr4_aa                                                                                                                     | True if fwr4_aa is equal to substring in sequence cut from position fwr4_aa_start_aa up to fwr4_aa_end_aa. If fwr4_aa_end_aa is -1 (missing), j_sequence_end_aa is used as an ending offset instead.      |
| no_empty_fwr1_aa_in_v                     | v_sequence_alignment_aa; fwr1_aa                                                                                                                                                           | True if fwr1_aa is present.                                                                                                                                                                               |
| no_empty_cdr1_aa_in_v                     | v_sequence_alignment_aa; cdr1_aa                                                                                                                                                           | True if cdr1_aa is present.                                                                                                                                                                               |
| no_empty_fwr2_aa_in_v                     | v_sequence_alignment_aa; fwr2_aa                                                                                                                                                           | True if fwr2_aa is present.                                                                                                                                                                               |
| no_empty_cdr2_aa_in_v                     | v_sequence_alignment_aa; cdr2_aa                                                                                                                                                           | True if cdr2_aa is present.                                                                                                                                                                               |
| no_empty_fwr3_aa_in_v                     | v_sequence_alignment_aa; fwr3_aa                                                                                                                                                           | True if fwr3_aa is present.                                                                                                                                                                               |
| no_empty_fwr4_aa_in_j                     | j_sequence_alignment_aa; fwr4_aa                                                                                                                                                           | True if fwr4_aa is present.                                                                                                                                                                               |
| conserved_C23_present                     | scheme_residue_mapping                                                                                                                                                                     | True if conserved Cysteine on IMGT position 23 is present.                                                                                                                                                |
| conserved_W41_present                     | scheme_residue_mapping                                                                                                                                                                     | True if conserved Tryptophan on IMGT position 41 is present.                                                                                                                                              |
| conserved_C104_present                    | scheme_residue_mapping                                                                                                                                                                     | True if conserved Cysteine on IMGT position 104 is present.                                                                                                                                               |
| conserved_W118_heavy_present              | scheme_residue_mapping                                                                                                                                                                     | True if conserved Tryptophan on IMGT position 118 is present (heavy chain only).                                                                                                                          |
| conserved_F118_light_present              | scheme_residue_mapping                                                                                                                                                                     | True if conserved Phenylalanine on IMGT position 118 is present (light chain only).                                                                                                                       |

## Examples
Sample usage of the software is presented at https://colab.research.google.com/drive/1xKO4udsX5gmnY88eDKWsQaUnHsLuFwVA?usp=sharing.
To give users the ability to use RIOT with a custom database, we provide google colab script which showcases how to build a custom germline database for RIOT. It is available at https://colab.research.google.com/drive/1VCStUKgZ1ggi2Xf5YV7hFWHxxzP29BjK?usp=sharing.


## Development

RIOT uses prefiltering module written in Rust, which requires some extra steps to install from source.

```
# Install Poetry

curl -sSL https://install.python-poetry.org | python3 - --version 1.7.1

# Add `export PATH="/root/.local/bin:$PATH"` to your shell configuration file.****

# Download and run the Rust installation script
curl --proto '=https' --tlsv1.2 -sSf https://sh.rustup.rs | sh -s -- -y

# Restart shell to reload PATH

# Verify the installation
!poetry --version
!rustc --version
!cargo --version

git clone https://github.com/NaturalAntibody/riot_na
cd riot_na

poetry install
poetry run maturin develop -r
poetry install
```

## Citing this work
The code and data in this package is based on the following paper <*we release the paper once it clears peer review*>. If you use it, please cite:
```
@misc{riot,
      title={RIOT - Rapid Immunoglobulin Overview Tool - rapid annotation of nucleotide and amino acid immunoglobulin sequences using an open germline database.},
      author={Paweł Dudzic, Bartosz Janusz, Tadeusz Satława, Dawid Chomicz, Tomasz Gawłowski, Rafał Grabowski, Przemysław Jóźwiak, Mateusz Tarkowski, Maciej Mycielski, Sonia Wróbel, Konrad Krawczyk*},

}
```

