#!python
#    ANARCI - Antibody Numbering and Antigen Receptor ClassIfication
#    Copyright (C) 2016 Oxford Protein Informatics Group (OPIG)
#
#    This program is free software: you can redistribute it and/or modify
#    it under the terms of the BSD 3-Clause License.
#
#    You should have received a copy of the BSD 3-Clause Licence
#    along with this program.  If not, see <https://opensource.org/license/bsd-3-clause/>.

description='''

ANARCI                                                 \\\    //
Antibody Numbering and Antigen Receptor ClassIfication  \\\  //
                                                          ||
(c) Oxford Protein Informatics Group (OPIG). 2015-17      ||

Usage:

ANARCI -i <inputsequence or fasta file>

Requirements:
 -  HMMER3 version 3.1b1 or higher - http://hmmer.janelia.org/ 

e.g. 
    ANARCI -i Example_sequence_files/12e8.fasta 
    This will number the files in 12e8.fasta with imgt numbering scheme and print to stdout.

    ANARCI -i Example_sequence_files/sequences.fasta -o Numbered_sequences.anarci -ht hit_tables.txt -s chothia -r ig 
    This will number the files in sequences.fasta with chothia numbering scheme only if they are an antibody chain (ignore TCRs).
    It will put the numbered sequences in Numbered_sequences.anarci and the alignment statistics in hit_tables.txt
    
    ANARCI -i Example_sequence_files/lysozyme.fasta
    No antigen receptors should be found. The program will just list the names of the sequences. 

    ANARCI -i EVQLQQSGAEVVRSGASVKLSCTASGFNIKDYYIHWVKQRPEKGLEWIGWIDPEIGDTEYVPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNAGHDYDRGRFPYWGQGTLVTVSA
    Or just give a single sequence to be numbered. 
'''

epilogue='''
Author: James Dunbar (dunbar@stats.ox.ac.uk)
        Charlotte Deane (deane@stats.ox.ac.uk)

Contact: opig@stats.ox.ac.uk

Copyright (C) 2017 Oxford Protein Informatics Group (OPIG)
Freely distributed under the BSD 3-Clause Licence.
'''
import os

def which(name, flags=os.X_OK):
    """
    Search PATH for executable files with the given name.
   
    On newer versions of MS-Windows, the PATHEXT environment variable will be
    set to the list of file extensions for files considered executable. This
    will normally include things like ".EXE". This fuction will also find files
    with the given name ending with any of these extensions.

    On MS-Windows the only flag that has any meaning is os.F_OK. Any other
    flags will be ignored.
   
    @type name: C{str}
    @param name: The name for which to search.
   
    @type flags: C{int}
    @param flags: Arguments to L{os.access}.
   
    @rtype: C{list}
    @param: A list of the unique full paths to files found, in the
    order in which they were found.
    """
    result = []
    exts = [_f for _f in os.environ.get('PATHEXT', '').split(os.pathsep) if _f]
    path = os.environ.get('PATH', None)
    if path is None:
        return []
    for p in os.environ.get('PATH', '').split(os.pathsep):
        p = os.path.join(p, name)
        if os.access(p, flags):
            result.append(p)
        for e in exts:
            pext = p + e
            if os.access(pext, flags):
                result.append(pext)
    return list(set(result))
  
if __name__ == "__main__":
    import argparse, sys
    try: # Import the anarci functions.
        from anarci import scheme_names, wrap , all_species, run_anarci
    except ImportError as e:
        print("Fatal Error:", e, file=sys.stderr)
        sys.exit(1)

    parser = argparse.ArgumentParser(prog="ANARCI", description=description, epilog=epilogue,formatter_class=argparse.RawDescriptionHelpFormatter)
    parser.add_argument( '--sequence','-i', type=str, help="A sequence or an input fasta file", dest="inputsequence")
    parser.add_argument( '--outfile','-o', type=str, default=False, help="The output file to use. Default is stdout", dest="outfile")
    parser.add_argument( '--scheme','-s', type=str, choices=scheme_names, default="imgt", help="Which numbering scheme should be used. i, k, c, m, w and a are shorthand for IMGT, Kabat, Chothia, Martin (Extended Chothia), Wolfguy and Aho respectively. Default IMGT", dest="scheme")
    parser.add_argument( '--restrict','-r', type=str, nargs="+", choices=["ig","tr","heavy", "light", "H", "K", "L", "A", "B"], default=False, help="Restrict ANARCI to only recognise certain types of receptor chains.", dest="restrict")    
    parser.add_argument( '--csv', action='store_true', default=False, help="Write the output in csv format. Outfile must be specified. A csv file is written for each chain type <outfile>_<chain_type>.csv. Kappa and lambda are considered together.", dest="csv")
    parser.add_argument( '--outfile_hits','-ht', type=str, default=False, help="Output file for domain hit tables for each sequence. Otherwise not output.", dest="hitfile")
    parser.add_argument( '--hmmerpath','-hp', type=str, default="", help="The path to the directory containing hmmer programs. (including hmmscan)", dest="hmmerpath")
    parser.add_argument( '--ncpu','-p', type=int, default=1, help="Number of parallel processes to use. Default is 1.", dest="ncpu")
    parser.add_argument( '--assign_germline', action = 'store_true', default=False, help="Assign the v and j germlines to the sequence. The most sequence identical germline is assigned.", dest="assign_germline")
    parser.add_argument( '--use_species', type=str, help="Use a specific species in the germline assignment. If not specified, only human and mouse germlines will be considered.", choices=all_species, dest="use_species")
    parser.add_argument( '--bit_score_threshold', type=int, default=80, help="Change the bit score threshold used to confirm an alignment should be used.", dest="bit_score_threshold")

    args = parser.parse_args()

    ######################
    # Input housekeeping #
    ######################
    if len(sys.argv) <2:
        parser.print_help()
        sys.exit(0)
        
    outfile = False
    if args.outfile:
        path, fname = os.path.split(args.outfile)
        if (not path) or os.path.exists(path):
            outfile = args.outfile
        else:
            print("Error: Output file path does not exist", file=sys.stderr)
            sys.exit(1)

    if args.csv and not args.outfile:
        print("Error: When --csv option is used an ouput file name must be given.", file=sys.stderr)
        sys.exit(1)
        

    hitfile = False
    if args.hitfile:
        path, fname = os.path.split(args.hitfile)
        if (not path) or os.path.exists(path):
            hitfile = args.hitfile
        else:
            print("Error: Hit output file path does not exist", file=sys.stderr)
            sys.exit(1)
    
    # Check that hmmscan can be found in the path
    if args.hmmerpath:
        hmmerpath=args.hmmerpath
        scan_path = os.path.join( hmmerpath, "hmmscan" )
        if not ( os.path.exists( scan_path ) and os.access(scan_path, os.X_OK)):
            print("Error: No hmmscan executable file found in directory: %s"%(hmmerpath), file=sys.stderr)
            sys.exit(1)
    elif not which("hmmscan"):
        print("Error: hmmscan was not found in the path. Either install and add to path or provide path with commandline option.", file=sys.stderr)
        sys.exit(1)
    
    
    # Check if there should be some restriction as to which chain types should be numbered.
    # If it is not the imgt scheme they want then restrict to only igs (otherwise you'll hit assertion errors)
    types_to_chains = {"ig":["H","K","L"], "tr":["A", "B","G","D"], "heavy":["H"], "light":["K","L"] }
    if args.restrict:
        allow = []
        for r in args.restrict:
            try:
                allow += types_to_chains[r]
            except KeyError:
                allow.append(r)
        allow = set(allow)
    else:
        allow = set(["H","K","L","A","B","G","D"])
    if args.scheme not in ("imgt","i", "aho","a") and allow - set(["H","K","L"]):
        print("Warning: Non IG chains cannot be numbered with the %s scheme. These will be ignored."%args.scheme, file=sys.stderr)
        allow = allow - set(["A","B","G","D"])
        
    allowed_species = ['human', 'mouse']
    
    if args.use_species:
        assert args.use_species in all_species, 'Unknown species'
        allowed_species = [args.use_species]
    
    
    ###########################
    # Do numbering and output #
    ###########################
    try:
        sequences, numbered, alignment_details, hit_tables =  run_anarci(args.inputsequence, scheme=args.scheme, output=True, 
                                                          outfile=outfile, csv=args.csv, allow=allow, ncpu=args.ncpu, 
                                                          assign_germline=args.assign_germline, allowed_species=allowed_species, 
                                                          bit_score_threshold=args.bit_score_threshold )

        if hitfile:
            with open( hitfile, "w") as outfile:
                print("# Hit file for ANARCI", file=outfile)
                for i in range(len(sequences)):
                    name, sequence = sequences[i]
                    print("NAME    ", name, file=outfile)
                    print("SEQUENCE "+'\n'.join(['\nSEQUENCE '.join(wrap(block, width=71)) for block in sequence.splitlines()]), file=outfile)
                    
                    pad = max(list(map( len, hit_tables[i][0] )) )
                    for line in hit_tables[i]:
                        print(" ".join( [ str(_).rjust(pad) for _ in line  ]), file=outfile)
                    print("//", file=outfile)
    except Exception as e:
        # An error occurred. Report to screen and die gracefully.            
        print("Error: ", e, file=sys.stderr)
        sys.exit(1)
        
    sys.exit(0)



