Metadata-Version: 2.4
Name: fastembed-bio
Version: 0.1.0
Summary: Fast, light, accurate library for biological sequence embeddings (proteins, DNA, RNA)
License: Apache License
License-File: LICENSE
License-File: NOTICE
Keywords: vector,embedding,protein,esm2,bioinformatics,onnx,biological-sequences
Author: Nathan LeRoy
Author-email: nathanjleroy@gmail.com
Requires-Python: >=3.10.0
Classifier: License :: Other/Proprietary License
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3.10
Classifier: Programming Language :: Python :: 3.11
Classifier: Programming Language :: Python :: 3.12
Classifier: Programming Language :: Python :: 3.13
Classifier: Programming Language :: Python :: 3.14
Requires-Dist: huggingface-hub (>=0.20,<2.0)
Requires-Dist: loguru (>=0.7.2,<0.8.0)
Requires-Dist: mmh3 (>=4.1.0,<6.0.0)
Requires-Dist: numpy (>=1.21) ; python_version == "3.11"
Requires-Dist: numpy (>=1.21,<2.3.0) ; python_version == "3.10"
Requires-Dist: numpy (>=1.26) ; python_version == "3.12"
Requires-Dist: numpy (>=2.1.0) ; python_version == "3.13"
Requires-Dist: numpy (>=2.3.0) ; python_version >= "3.14"
Requires-Dist: onnxruntime (>1.20.0) ; python_version >= "3.13"
Requires-Dist: onnxruntime (>=1.17.0,!=1.20.0) ; python_version >= "3.10" and python_version < "3.13"
Requires-Dist: pillow (>=10.3.0,<11.0) ; python_version < "3.10"
Requires-Dist: pillow (>=10.3.0,<12.0) ; python_version >= "3.10" and python_version < "3.13"
Requires-Dist: pillow (>=11.0.0,<12.0) ; python_version >= "3.13"
Requires-Dist: py-rust-stemmers (>=0.1.0,<0.2.0)
Requires-Dist: requests (>=2.31,<3.0)
Requires-Dist: tokenizers (>=0.15,<1.0)
Requires-Dist: tqdm (>=4.66,<5.0)
Project-URL: Homepage, https://github.com/nleroy917/fastembed-bio
Project-URL: Repository, https://github.com/nleroy917/fastembed-bio
Description-Content-Type: text/markdown

# ⚡️ What is FastEmbed?

FastEmbed is a lightweight, fast, Python library built for embedding generation. We [support popular text models](https://qdrant.github.io/fastembed/examples/Supported_Models/). Please [open a GitHub issue](https://github.com/qdrant/fastembed/issues/new) if you want us to add a new model.

The default text embedding (`TextEmbedding`) model is Flag Embedding, presented in the [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard. It supports "query" and "passage" prefixes for the input text. Here is an example for [Retrieval Embedding Generation](https://qdrant.github.io/fastembed/qdrant/Retrieval_with_FastEmbed/) and how to use [FastEmbed with Qdrant](https://qdrant.github.io/fastembed/qdrant/Usage_With_Qdrant/).

## 📈 Why FastEmbed?

1. Light: FastEmbed is a lightweight library with few external dependencies. We don't require a GPU and don't download GBs of PyTorch dependencies, and instead use the ONNX Runtime. This makes it a great candidate for serverless runtimes like AWS Lambda. 

2. Fast: FastEmbed is designed for speed. We use the ONNX Runtime, which is faster than PyTorch. We also use data parallelism for encoding large datasets.

3. Accurate: FastEmbed is better than OpenAI Ada-002. We also [support](https://qdrant.github.io/fastembed/examples/Supported_Models/) an ever-expanding set of models, including a few multilingual models.

## 🚀 Installation

To install the FastEmbed library, pip works best. You can install it with or without GPU support:

```bash
pip install fastembed

# or with GPU support

pip install fastembed-gpu
```

## 📖 Quickstart

```python
from fastembed import TextEmbedding


# Example list of documents
documents: list[str] = [
    "This is built to be faster and lighter than other embedding libraries e.g. Transformers, Sentence-Transformers, etc.",
    "fastembed is supported by and maintained by Qdrant.",
]

# This will trigger the model download and initialization
embedding_model = TextEmbedding()
print("The model BAAI/bge-small-en-v1.5 is ready to use.")

embeddings_generator = embedding_model.embed(documents)  # reminder this is a generator
embeddings_list = list(embedding_model.embed(documents))
  # you can also convert the generator to a list, and that to a numpy array
len(embeddings_list[0]) # Vector of 384 dimensions
```

Fastembed supports a variety of models for different tasks and modalities.
The list of all the available models can be found [here](https://qdrant.github.io/fastembed/examples/Supported_Models/)
### 🎒 Dense text embeddings

```python
from fastembed import TextEmbedding

model = TextEmbedding(model_name="BAAI/bge-small-en-v1.5")
embeddings = list(model.embed(documents))

# [
#   array([-0.1115,  0.0097,  0.0052,  0.0195, ...], dtype=float32),
#   array([-0.1019,  0.0635, -0.0332,  0.0522, ...], dtype=float32)
# ]

```

Dense text embedding can also be extended with models which are not in the list of supported models.

```python
from fastembed import TextEmbedding
from fastembed.common.model_description import PoolingType, ModelSource

TextEmbedding.add_custom_model(
    model="intfloat/multilingual-e5-small",
    pooling=PoolingType.MEAN,
    normalization=True,
    sources=ModelSource(hf="intfloat/multilingual-e5-small"),  # can be used with an `url` to load files from a private storage
    dim=384,
    model_file="onnx/model.onnx",  # can be used to load an already supported model with another optimization or quantization, e.g. onnx/model_O4.onnx
)
model = TextEmbedding(model_name="intfloat/multilingual-e5-small")
embeddings = list(model.embed(documents))
```


### 🔱 Sparse text embeddings

* SPLADE++

```python
from fastembed import SparseTextEmbedding

model = SparseTextEmbedding(model_name="prithivida/Splade_PP_en_v1")
embeddings = list(model.embed(documents))

# [
#   SparseEmbedding(indices=[ 17, 123, 919, ... ], values=[0.71, 0.22, 0.39, ...]),
#   SparseEmbedding(indices=[ 38,  12,  91, ... ], values=[0.11, 0.22, 0.39, ...])
# ]
```

<!--
* BM42 - ([link](ToDo))

```
from fastembed import SparseTextEmbedding

model = SparseTextEmbedding(model_name="Qdrant/bm42-all-minilm-l6-v2-attentions")
embeddings = list(model.embed(documents))

# [
#   SparseEmbedding(indices=[ 17, 123, 919, ... ], values=[0.71, 0.22, 0.39, ...]),
#   SparseEmbedding(indices=[ 38,  12,  91, ... ], values=[0.11, 0.22, 0.39, ...])
# ]
```
-->

### 🦥 Late interaction models (aka ColBERT)


```python
from fastembed import LateInteractionTextEmbedding

model = LateInteractionTextEmbedding(model_name="colbert-ir/colbertv2.0")
embeddings = list(model.embed(documents))

# [
#   array([
#       [-0.1115,  0.0097,  0.0052,  0.0195, ...],
#       [-0.1019,  0.0635, -0.0332,  0.0522, ...],
#   ]),
#   array([
#       [-0.9019,  0.0335, -0.0032,  0.0991, ...],
#       [-0.2115,  0.8097,  0.1052,  0.0195, ...],
#   ]),  
# ]
```

### 🖼️ Image embeddings

```python
from fastembed import ImageEmbedding

images = [
    "./path/to/image1.jpg",
    "./path/to/image2.jpg",
]

model = ImageEmbedding(model_name="Qdrant/clip-ViT-B-32-vision")
embeddings = list(model.embed(images))

# [
#   array([-0.1115,  0.0097,  0.0052,  0.0195, ...], dtype=float32),
#   array([-0.1019,  0.0635, -0.0332,  0.0522, ...], dtype=float32)
# ]
```

### 🧬 Protein embeddings

```python
from fastembed import ProteinEmbedding

sequences = [
    "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
    "GKGDPKKPRGKMSSYAFFVQTSREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAK",
]

model = ProteinEmbedding(model_name="facebook/esm2_t12_35M_UR50D")
embeddings = list(model.embed(sequences))

# [
#   array([-0.0055, -0.0144,  0.0355, -0.0049, ...], dtype=float32),
#   array([ 0.0114,  0.0020, -0.0247,  0.0060, ...], dtype=float32)
# ]
```

### Late interaction multimodal models (ColPali)

```python
from fastembed import LateInteractionMultimodalEmbedding

doc_images = [
    "./path/to/qdrant_pdf_doc_1_screenshot.jpg",
    "./path/to/colpali_pdf_doc_2_screenshot.jpg",
]

query = "What is Qdrant?"

model = LateInteractionMultimodalEmbedding(model_name="Qdrant/colpali-v1.3-fp16")
doc_images_embeddings = list(model.embed_image(doc_images))
# shape (2, 1030, 128)
# [array([[-0.03353882, -0.02090454, ..., -0.15576172, -0.07678223]], dtype=float32)]
query_embedding = model.embed_text(query)
# shape (1, 20, 128)
# [array([[-0.00218201,  0.14758301, ...,  -0.02207947,  0.16833496]], dtype=float32)]
```

### 🔄 Rerankers
```python
from fastembed.rerank.cross_encoder import TextCrossEncoder

query = "Who is maintaining Qdrant?"
documents: list[str] = [
    "This is built to be faster and lighter than other embedding libraries e.g. Transformers, Sentence-Transformers, etc.",
    "fastembed is supported by and maintained by Qdrant.",
]
encoder = TextCrossEncoder(model_name="Xenova/ms-marco-MiniLM-L-6-v2")
scores = list(encoder.rerank(query, documents))

# [-11.48061752319336, 5.472434997558594]
```

Text cross encoders can also be extended with models which are not in the list of supported models.

```python
from fastembed.rerank.cross_encoder import TextCrossEncoder 
from fastembed.common.model_description import ModelSource

TextCrossEncoder.add_custom_model(
    model="Xenova/ms-marco-MiniLM-L-4-v2",
    model_file="onnx/model.onnx",
    sources=ModelSource(hf="Xenova/ms-marco-MiniLM-L-4-v2"),
)
model = TextCrossEncoder(model_name="Xenova/ms-marco-MiniLM-L-4-v2")
scores = list(model.rerank_pairs(
    [("What is AI?", "Artificial intelligence is ..."), ("What is ML?", "Machine learning is ..."),]
))
```

## ⚡️ FastEmbed on a GPU

FastEmbed supports running on GPU devices.
It requires installation of the `fastembed-gpu` package.

```bash
pip install fastembed-gpu
```

Check our [example](https://qdrant.github.io/fastembed/examples/FastEmbed_GPU/) for detailed instructions, CUDA 12.x support and troubleshooting of the common issues.

```python
from fastembed import TextEmbedding

embedding_model = TextEmbedding(
    model_name="BAAI/bge-small-en-v1.5", 
    providers=["CUDAExecutionProvider"]
)
print("The model BAAI/bge-small-en-v1.5 is ready to use on a GPU.")

```

## Usage with Qdrant

Installation with Qdrant Client in Python:

```bash
pip install qdrant-client[fastembed]
```

or 

```bash
pip install qdrant-client[fastembed-gpu]
```

You might have to use quotes ```pip install 'qdrant-client[fastembed]'``` on zsh.

```python
from qdrant_client import QdrantClient, models

# Initialize the client
client = QdrantClient("localhost", port=6333) # For production
# client = QdrantClient(":memory:") # For experimentation

model_name = "sentence-transformers/all-MiniLM-L6-v2"
payload = [
    {"document": "Qdrant has Langchain integrations", "source": "Langchain-docs", },
    {"document": "Qdrant also has Llama Index integrations", "source": "LlamaIndex-docs"},
]
docs = [models.Document(text=data["document"], model=model_name) for data in payload]
ids = [42, 2]

client.create_collection(
    "demo_collection",
    vectors_config=models.VectorParams(
        size=client.get_embedding_size(model_name), distance=models.Distance.COSINE)
)

client.upload_collection(
    collection_name="demo_collection",
    vectors=docs,
    ids=ids,
    payload=payload,
)

search_result = client.query_points(
    collection_name="demo_collection",
    query=models.Document(text="This is a query document", model=model_name)
).points
print(search_result)
```
