Metadata-Version: 2.4
Name: amylodeep
Version: 0.1.1
Summary: Prediction of amyloid propensity from amino acid sequences using ensemble deep learning and LLM models
Author-email: Alisa Davtyan <alisadavtyan7@gmail.com>
License: MIT
Project-URL: Repository, https://github.com/AlisaDavtyan/protein_classification
Project-URL: Bug Tracker, https://github.com/AlisaDavtyan/protein_classification/issues
Keywords: bioinformatics,amyloid,deep learning,protein,sequence classification
Classifier: Development Status :: 3 - Alpha
Classifier: Intended Audience :: Science/Research
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: License :: OSI Approved :: MIT License
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3.8
Classifier: Programming Language :: Python :: 3.9
Classifier: Programming Language :: Python :: 3.10
Classifier: Programming Language :: Python :: 3.11
Requires-Python: >=3.8
Description-Content-Type: text/markdown
License-File: LICENSE
Requires-Dist: torch>=1.12.0
Requires-Dist: transformers>=4.30.0
Requires-Dist: xgboost>=1.7.0
Requires-Dist: numpy>=1.20
Requires-Dist: pandas>=1.3
Requires-Dist: scikit-learn>=1.0
Requires-Dist: jax-unirep>=2.0.0
Requires-Dist: wandb>=0.14
Requires-Dist: toml>=0.10.2
Provides-Extra: ui
Requires-Dist: streamlit>=1.18; extra == "ui"
Requires-Dist: matplotlib>=3.5; extra == "ui"
Provides-Extra: dev
Requires-Dist: pytest>=6.0; extra == "dev"
Requires-Dist: black>=22.0; extra == "dev"
Requires-Dist: flake8>=3.9; extra == "dev"
Dynamic: license-file

# AmyloDeep

**Prediction of amyloid propensity from amino acid sequences using deep learning**

AmyloDeep is a Python package that uses a 5-model ensemble to predict amyloidogenic regions in protein sequences using a rolling window approach. The package combines multiple state-of-the-art machine learning models including ESM2 transformers, UniRep embeddings, SVM, and XGBoost to provide accurate amyloid propensity predictions.

## Features

- **Multi-model ensemble**: Combines 5 different models for robust predictions
- **Rolling window analysis**: Analyzes sequences using sliding windows of configurable size
- **Pre-trained models**: Uses models trained on amyloid sequence databases
- **Calibrated probabilities**: Includes probability calibration for better confidence estimates
- **Easy-to-use API**: Simple Python interface and command-line tool
- **Streamlit web interface**: Optional web interface for interactive predictions

## Installation

### From PyPI (recommended)

```bash
pip install amylodeep
```

### From source

```bash
git clone https://github.com/AlisaDavtyan/protein_classification.git
cd amylodeep
pip install -e .
```



For development:
```bash
pip install amylodeep[dev]
```

## Quick Start

### Python API

```python
from amylodeep import predict_ensemble_rolling

# Predict amyloid propensity for a protein sequence
sequence = "MKTFFFLLLLFTIGFCYVQFSKLKLENLHFKDNSEGLKNGGLQRQLGLTLKFNSNSLHHTSNL"
result = predict_ensemble_rolling(sequence, window_size=6)

print(f"Average probability: {result['avg_probability']:.4f}")
print(f"Maximum probability: {result['max_probability']:.4f}")

# Access position-wise probabilities
for position, probability in result['position_probs']:
    print(f"Position {position}: {probability:.4f}")
```

### Command Line Interface

```bash
# Basic prediction
amylodeep "MKTFFFLLLLFTIGFCYVQFSKLKLENLHFKDNSEGLKNGGLQRQLGLTLKFNSNSLHHTSNL"

# With custom window size
amylodeep "SEQUENCE" --window-size 10

# Save results to file
amylodeep "SEQUENCE" --output results.json --format json

# CSV output
amylodeep "SEQUENCE" --output results.csv --format csv
```


## Model Architecture

AmyloDeep uses an ensemble of 5 models:

1. **ESM2-150M**: Fine-tuned ESM2 transformer (150M parameters)
2. **UniRep**: UniRep-based neural network classifier
3. **ESM2-650M**: Custom classifier using ESM2-650M embeddings
4. **SVM**: Support Vector Machine with ESM2 embeddings
5. **XGBoost**: Gradient boosting with ESM2 embeddings

The models are combined using probability averaging, with some models using probability calibration (Platt scaling or isotonic regression) for better confidence estimates.

## Requirements

- Python >= 3.8
- PyTorch >= 1.9.0
- Transformers >= 4.15.0
- NumPy >= 1.20.0
- scikit-learn >= 1.0.0
- XGBoost >= 1.5.0
- jax-unirep >= 2.0.0
- wandb >= 0.12.0




### Main Functions

#### `predict_ensemble_rolling(sequence, window_size=6)`

Predict amyloid propensity for a protein sequence using rolling window analysis.

**Parameters:**
- `sequence` (str): Protein sequence (amino acid letters)
- `window_size` (int): Size of the rolling window (default: 6)

**Returns:**
Dictionary containing:
- `position_probs`: List of (position, probability) tuples
- `avg_probability`: Average probability across all windows
- `max_probability`: Maximum probability across all windows
- `sequence_length`: Length of the input sequence
- `num_windows`: Number of windows analyzed


Individual model classes for ESM and UniRep-based predictions.

## Contributing

We welcome contributions! Please see our contributing guidelines for more information.

## License

This project is licensed under the MIT License - see the LICENSE file for details.

## Citation

If you use AmyloDeep in your research, please cite:

```bibtex
@software{amylodeep2025,
  title={AmyloDeep: Prediction of amyloid propensity from amino acid sequences using deep learning},
  author={Alisa Davtyan},
  year={2025},
  url={https://github.com/AlisaDavtyan/protein_classification}
}
```

## Support

For questions and support:
- Open an issue on GitHub
- Contact: alisadavtyan7@gmail.com

## Changelog

### v0.1.0
- Initial release
- 5-model ensemble implementation
- Rolling window prediction
- Command-line interface
- Python API
