Source code for macsypy.database

#########################################################################
# MacSyFinder - Detection of macromolecular systems in protein dataset  #
#               using systems modelling and similarity search.          #
# Authors: Sophie Abby, Bertrand Neron                                  #
# Copyright (c) 2014-2024  Institut Pasteur (Paris) and CNRS.           #
# See the COPYRIGHT file for details                                    #
#                                                                       #
# This file is part of MacSyFinder package.                             #
#                                                                       #
# MacSyFinder is free software: you can redistribute it and/or modify   #
# it under the terms of the GNU General Public License as published by  #
# the Free Software Foundation, either version 3 of the License, or     #
# (at your option) any later version.                                   #
#                                                                       #
# MacSyFinder is distributed in the hope that it will be useful,        #
# but WITHOUT ANY WARRANTY; without even the implied warranty of        #
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the          #
# GNU General Public License for more details .                         #
#                                                                       #
# You should have received a copy of the GNU General Public License     #
# along with MacSyFinder (COPYING).                                     #
# If not, see <https://www.gnu.org/licenses/>.                          #
#########################################################################

"""
Module to handle sequences and their indexes
"""
from itertools import groupby
from collections import namedtuple
import os.path
import logging

from .error import MacsypyError, EmptyFileError
from .utils import open_compressed


from typing import TextIO, Iterator, Literal, TypeAlias, Any
from .config import Config

_log = logging.getLogger(__name__)


Topology: TypeAlias = Literal['linear', 'ciircular']


[docs]def fasta_iter(fasta_file: TextIO) -> Iterator[tuple[str, str, int]]: """ :param fasta_file: the file containing all input sequences in fasta format. :author: http://biostar.stackexchange.com/users/36/brentp :return: for a given fasta file, it returns an iterator which yields tuples (string id, string comment, int sequence length) """ # ditch the boolean (x[0]) and just keep the header or sequence since # we know they alternate. faiter = (x[1] for x in groupby(fasta_file, lambda line: line[0] == ">")) for header in faiter: # drop the ">" header = next(header)[1:].strip() header = header.split() _id = header[0] comment = ' '.join(header[1:]) try: seq = ''.join(s.strip() for s in next(faiter)) except StopIteration: # the sequence was not start by '>' # bad fasta format msg = f"Error during sequence '{fasta_file.name}' parsing: Check the fasta format." _log.critical(msg) raise MacsypyError(msg) length = len(seq) yield _id, comment, length
[docs]class Indexes: """ Handle the indexes for macsyfinder: - find the indexes required by macsyfinder to compute some scores, or build them. """ _field_separator = "^^"
[docs] def __init__(self, cfg: Config) -> None: """ The constructor retrieves the file of indexes in the case they are not present or the user asked for build indexes (--idx) Launch the indexes building. :param cfg: the configuration :type cfg: :class:`macsypy.config.Config` object """ self.cfg = cfg self._fasta_path = cfg.sequence_db() self.name = os.path.basename(self._fasta_path)
[docs] def build(self, force: bool = False) -> str: """ Build the indexes from the sequence data set in fasta format, :param force: If True, force the index building even if the index files are present in the sequence data set folder :return: the path to the index """ my_indexes = self.find_my_indexes() # check read ########################### # build indexes if needed # ########################### if my_indexes and not force: with open(my_indexes) as idx: seq_path = next(idx).strip() try: first_item = next(idx).strip() except StopIteration: # there is only one line in file first_item = None if seq_path.count(';') == 2: # there is no path in idx, it's an old index _log.warning(f"The '{my_indexes}' index file is in old format. Force index building.") force = True elif seq_path != self._fasta_path: _log.warning(f"The '{my_indexes}' index file does not point to '{self._fasta_path}'. Force building") force = True if not force and first_item: # the first line of idx is a valid path if first_item.count(self._field_separator) == 0: # the separator is different than the actual separator _log.warning(f"The '{my_indexes}' index file is in old format. Force index building.") force = True # if fasta file is newer than idx stamp_fasta = os.path.getmtime(self._fasta_path) stamp_idx = os.path.getmtime(my_indexes) if stamp_idx < stamp_fasta: _log.debug("the sequence index is older than sequence file: rebuild the index.") force = True if force or not my_indexes: try: index_dir = self._index_dir(build=True) # check build except ValueError as err: msg = str(err) _log.critical(msg) raise IOError(msg) from None my_indexes = self._build_my_indexes(index_dir) return my_indexes
[docs] def find_my_indexes(self) -> str | None: """ :return: the file of macsyfinder indexes if it exists in the dataset folder, None otherwise. :rtype: string """ index_dir = self._index_dir(build=False) path = os.path.join(index_dir, self.name + ".idx") if os.path.exists(path): return path
[docs] def _index_dir(self, build: bool = False) -> str: """ search where to store(build=True) read indexes :param build: if check the index-dir permissions to write :return: The directory where read or write the indexes :raise ValueError: if the directory specify by --index-dir option does not exist or if build = True index-dir is not writable """ index_dir = self.cfg.index_dir() if index_dir: if not os.path.exists(index_dir): raise ValueError(f"No such directory: {index_dir}") elif build and not os.access(index_dir, os.W_OK): raise ValueError(f"The '{index_dir}' dir is not writable.") else: return index_dir else: # we need abspath because if user provide filename not path for sequence_db # for instance my_seq.faste instead of ./my_seq.fasta # then index_dir is empty string # and os.access return False index_dir = os.path.dirname(os.path.abspath(self.cfg.sequence_db())) if build and not os.access(index_dir, os.W_OK): raise ValueError(f"The '{index_dir}' dir is not writable. Change rights or specify --index-dir.") else: return index_dir
[docs] def _build_my_indexes(self, index_dir: str) -> str: """ Build macsyfinder indexes. These indexes are stored in a file. The file format is the following: - the first line is the path of the sequence-db indexed - one entry per line, with each line having this format: - sequence id;sequence length;sequence rank """ index_file = os.path.join(index_dir, self.name + ".idx") try: with open_compressed(self._fasta_path, 'rt') as fasta_file: with open(index_file, 'w') as my_base: my_base.write(self._fasta_path + '\n') f_iter = fasta_iter(fasta_file) seq_nb = 0 for seq_id, comment, length in f_iter: seq_nb += 1 my_base.write(f"{seq_id}{self._field_separator}{length:d}{self._field_separator}{seq_nb:d}\n") my_base.flush() except ValueError as err: msg = f"Cannot index '{self._fasta_path}': {err}" _log.critical(msg) raise MacsypyError(msg) except Exception as err: msg = f"unable to index the sequence dataset: {self.cfg.sequence_db()} : {err}" _log.critical(msg, exc_info=True) raise MacsypyError(msg) from err if seq_nb == 0: os.unlink(index_file) msg = f"The sequence-db file '{self._fasta_path}' does not contains sequences." raise EmptyFileError(msg) return index_file
[docs] def __iter__(self) -> Iterator[tuple[str, str, int]]: """ :raise MacsypyError: if the indexes are not buid :return: an iterator on the indexes To use it the index must be built. """ path = self.find_my_indexes() if path is None: raise MacsypyError("Build index before to use it.") with open(path) as idx_file: # The first line of index is the path to the data # It is not an index _ = next(idx_file) for line in idx_file: try: seq_id, length, _rank = line.split(self._field_separator) except Exception as err: raise MacsypyError(f"fail to parse database index {path} at line: {line}." f"Try to rebuild index with --idx option or remove file." f"If error persist feel free to submit an issue at" f"https://github.com/gem-pasteur/macsyfinder/issues/new?assignees=&labels=bug&template=bug_report.md&title=%5BBUG%5D ", err) from err length = int(length) _rank = int(_rank) yield seq_id, length, _rank
RepliconInfo = namedtuple('RepliconInfo', ('topology', 'min', 'max', 'genes')) """ handle information about a replicon .. py:attribute:: topology :noindex: The type of replicon topology 'linear or 'circular' .. py:attribute:: min :noindex: The position of the last gene of the replicon in the sequence dataset. .. py:attribute:: max :noindex: The position of the last gene of the replicon in the sequence dataset. .. py:attribute:: genes :noindex: A list of genes beloging to the replicon. Each genes is representing by a tuple (str seq_id, int length) """
[docs]class RepliconDB: """ Stores information (topology, min, max, [genes]) for all replicons in the sequence_db the Replicon object must be instantiated only for sequence_db of type 'gembase' or 'ordered_replicon' """
[docs] def __init__(self, cfg: Config) -> None: """ :param cfg: The configuration object :type cfg: :class:`macsypy.config.Config` object .. note :: This class can be instanced only if the db_type is 'gembase' or 'ordered_replicon' """ self.cfg = cfg assert self.cfg.db_type() in ('gembase', 'ordered_replicon') self._idx = Indexes(self.cfg) self.topology_file = self.cfg.topology_file() self._DB = {} if self.topology_file: topo_dict = self._fill_topology() else: topo_dict = {} if self.cfg.db_type() == 'gembase': self._fill_gembase_min_max(topo_dict, default_topology=self.cfg.replicon_topology()) else: self._ordered_replicon_name = os.path.splitext(os.path.basename(self.cfg.sequence_db()))[0] self._fill_ordered_min_max(self.cfg.replicon_topology())
@property def ordered_replicon_name(self) -> str: return self._ordered_replicon_name
[docs] def guess_if_really_gembase(self) -> bool: """ Count the number of replicon with only on sequence if this number is above a threshold may be it's not gembase. for instance the folowing sequence have id compliant with the gembase id syntax but it's not it only contains one replicon ('ordered replicon') | >1E10S0A0cP00_0010 D GTG TGA 483 2027 Valid dnaA 1545 _PA0001_NP_064721.1_ PA0001 1 483 2027 | MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNRFVLDW | >0200S001A0c_0P1E0 D ATG TAA 2056 3159 Valid dnaN 1104 _PA0002_NP_064722.1_ PA0002 1 2056 3159 | MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLE | >0000310E00S0c_1PA D ATG TGA 3169 4278 Valid recF 1110 _PA0003_NP_064723.1_ PA0003 1 3169 4278 | MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLAR | >c_01000A0PS00014E D ATG TGA 4275 6695 Valid gyrB 2421 _PA0004_NP_064724.1_ PA0004 1 4275 6695 | MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNSI | >07700ES100A0cP01_ C ATG TGA 91521 94826 Valid icmF1 3306 _PA0077_NP_248767.1_ PA0077 1 91521 94826 | MQSLAEVSAPDAASVAT :return: False if most replicon contains only one sequence, True otherwise """ all_len = [rep.max - rep.min for rep in self._DB.values()] replicon_with_one_seq = all_len.count(0) if replicon_with_one_seq > len(all_len) * 0.8: return False else: return True
[docs] def _fill_topology(self) -> dict[str: str]: """ Fill the internal dictionary with min and max positions for each replicon_name of the sequence_db """ topo_dict = {} with open(self.topology_file) as topo_f: for line in topo_f: if line.startswith('#'): continue replicon_name, topo = line.split(':') replicon_name = replicon_name.strip() topo = topo.strip().lower() topo_dict[replicon_name] = topo return topo_dict
[docs] def _fill_ordered_min_max(self, default_topology: Topology | None = None) -> None: """ For the replicon_name of the ordered_replicon sequence base, fill the internal dict with RepliconInfo :param default_topology: the topology provided by config.replicon_topology :type default_topology: string """ _min = 1 _max = 0 genes = [] for seq_id, length, _rank in self._idx: genes.append((seq_id, length)) _max += 1 self._DB[self.ordered_replicon_name] = RepliconInfo(default_topology, _min, _max, genes)
[docs] def _fill_gembase_min_max(self, topology: dict[str: Topology], default_topology: Topology) -> None: """ For each replicon_name of a gembase dataset, it fills the internal dictionary with a namedtuple RepliconInfo :param topology: the topologies for each replicon (parsed from the file specified with the option --topology-file) :param default_topology: the topology provided by the config.replicon_topology """ def grp_replicon(entry: str) -> str: """ in gembase the identifier of fasta sequence follows the following schema: <replicon-name>_<seq-name> with eventually '_' inside the <replicon_name> but not in the <seq-name>. for draft genome the seqname is postfix with 'b' if the sequence is border of the contig or 'i' if it is inside. so grp_replicon allow to group sequences belonging to the same replicon. """ return "_".join(entry[0].split('_')[: -1]).rstrip('ib') def parse_seq_id(seq_id): """ parse a gembase sequence id (.idx) seq_id has the following format <replicon-name>_<seq-name> with eventually '_' inside the <replicon_name> but not in the <seq-name>. """ *replicon_name, seq_name = seq_id.split('_') replicon_name = "_".join(replicon_name) return replicon_name, seq_name replicons = (x[1] for x in groupby(self._idx, grp_replicon)) for replicon in replicons: genes = [] seq_id, seq_length, _min = next(replicon) replicon_name, seq_name = parse_seq_id(seq_id) genes.append((seq_name, seq_length)) for seq_id, seq_length, rank in replicon: # pass all sequence of the replicon until the last one _, seq_name = parse_seq_id(seq_id) genes.append((seq_name, seq_length)) _, seq_name = parse_seq_id(seq_id) try: _max = rank except UnboundLocalError: # there is only one sequence for this replicon _max = _min genes.append((seq_name, seq_length)) if replicon_name in topology: self._DB[replicon_name] = RepliconInfo(topology[replicon_name], _min, _max, genes) else: self._DB[replicon_name] = RepliconInfo(default_topology, _min, _max, genes)
[docs] def __contains__(self, replicon_name: str) -> bool: """ :param replicon_name: the name of the replicon :returns: True if replicon_name is in the repliconDB, false otherwise. """ return replicon_name in self._DB
[docs] def __getitem__(self, replicon_name: str) -> RepliconInfo: """ :param replicon_name: the name of the replicon to get information on :returns: the RepliconInfo for the provided replicon_name :raise: KeyError if replicon_name is not in repliconDB """ return self._DB[replicon_name]
[docs] def get(self, replicon_name: str, default: Any = None) -> RepliconInfo: """ :param replicon_name: the name of the replicon to get information :param default: the value to return if the replicon_name is not in the RepliconDB :returns: the RepliconInfo for replicon_name if replicon_name is in the repliconDB, else default. If default is not given, it is set to None, so that this method never raises a KeyError. """ return self._DB.get(replicon_name, default)
[docs] def items(self) -> list[tuple[str, RepliconInfo]]: """ :return: a copy of the RepliconDB as a list of (replicon_name, RepliconInfo) pairs """ return list(self._DB.items())
[docs] def iteritems(self) -> Iterator[tuple[str, RepliconInfo]]: """ :return: an iterator over the RepliconDB as a list (replicon_name, RepliconInfo) pairs """ return iter(self._DB.items())
[docs] def replicon_names(self) -> list[str]: """ :return: a copy of the RepliconDB as a list of replicon_names """ return list(self._DB.keys())
[docs] def replicon_infos(self) -> list[RepliconInfo]: """ :return: a copy of the RepliconDB as list of replicons info :rtype: RepliconInfo instance """ return list(self._DB.values())